StarFunc result for job id Q92692

User Input

>input (538 residues)
MARAAALLPSRSPPTPLLWPLLLLLLLETGAQDVRVQVLPEVRGQLGGTVELPCHLLPPV
PGLYISLVTWQRPDAPANHQNVAAFHPKMGPSFPSPKPGSERLSFVSAKQSTGQDTEAEL
QDATLALHGLTVEDEGNYTCEFATFPKGSVRGMTWLRVIAKPKNQAEAQKVTFSQDPTTV
ALCISKEGRPPARISWLSSLDWEAKETQVSGTLAGTVTVTSRFTLVPSGRADGVTVTCKV
EHESFEEPALIPVTLSVRYPPEVSISGYDDNWYLGRTDATLSCDVRSNPEPTGYDWSTTS
GTFPTSAVAQGSQLVIHAVDSLFNTTFVCTVTNAVGMGRAEQVIFVRETPNTAGAGATGG
IIGGIIAAIIATAVAATGILICRQQRKEQTLQGAEEDEDLEGPPSYKPPTPKAKLEAQEM
PSQLFTLGASEHSPLKTPYFDAGASCTEQEMPRYHELPTLEERSGPLHPGATSLGSPIPV
PPGPPAVEDVSLDLEDEEGEEEEEYLDKINPIYDALSYSSPSDSYQGKGFVMSRAMYV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q92692	1.000	1.000	7.581E-93	538	1.000	1.000	Q92692.pdb.gz	NECT2_HUMAN Nectin-2 OS=Homo sapiens OX=9606 GN=NECTIN2 PE=1 SV=1
2	AFDB:P32507	0.642	0.652	6.109E-70	530	0.738	0.749	P32507.pdb.gz	NECT2_MOUSE Nectin-2 OS=Mus musculus OX=10090 GN=Nectin2 PE=1 SV=2
3	AFDB:P15151	0.567	0.724	2.082E-44	417	0.349	0.451	P15151.pdb.gz	PVR_HUMAN Poliovirus receptor OS=Homo sapiens OX=9606 GN=PVR PE=1 SV=2
4	AFDB:Q60977	0.506	0.639	1.158E-40	415	0.309	0.400	Q60977.pdb.gz	Q60977_MOUSE Tumor-associated glycoprotein E4 OS=Mus musculus OX=10090 GN=Pvr PE=2 SV=1
5	AFDB:Q5U334	0.524	0.671	2.687E-40	412	0.314	0.410	Q5U334.pdb.gz
6	AFDB:Q8BVF6	0.476	0.608	2.717E-39	408	0.299	0.395	Q8BVF6.pdb.gz	Q8BVF6_MOUSE Ig-like domain-containing protein OS=Mus musculus OX=10090 GN=Pvr PE=2 SV=1
7	AFDB:B0CLW6	0.503	0.791	3.122E-36	328	0.214	0.351	B0CLW6.pdb.gz	B0CLW6_DANRE PVR cell adhesion molecule related 2 like precursor OS=Danio rerio OX=7955 GN=si:dkey-225e11.1 PE=1 SV=1
8	AFDB:Q9JLB9	0.512	0.503	5.630E-35	549	0.242	0.237	Q9JLB9.pdb.gz	NECT3_MOUSE Nectin-3 OS=Mus musculus OX=10090 GN=Nectin3 PE=1 SV=1
9	AFDB:Q8NFZ8	0.388	0.512	4.011E-23	388	0.173	0.240	Q8NFZ8.pdb.gz	CADM4_HUMAN Cell adhesion molecule 4 OS=Homo sapiens OX=9606 GN=CADM4 PE=1 SV=1
10	AFDB:Q6PFK4	0.452	0.582	7.946E-23	405	0.182	0.242	Q6PFK4.pdb.gz	Q6PFK4_DANRE Cell adhesion molecule 2a OS=Danio rerio OX=7955 GN=zgc:66339 PE=1 SV=1
11	PDB:6dldD	0.356	0.636	3.018E-12	269	0.099	0.197	6dldD.pdb.gz
12	PDB:5oj2B	0.204	0.168	3.181E-12	692	0.102	0.079	5oj2B.pdb.gz
13	PDB:6dlfA	0.332	0.683	2.896E-11	236	0.082	0.186	6dlfA.pdb.gz
14	PDB:1igaA	0.183	0.203	9.209E-11	475	0.119	0.135	1igaA.pdb.gz
15	PDB:2rcjC	0.182	0.186	4.232E-10	523	0.123	0.126	2rcjC.pdb.gz
16	PDB:5c7kF	0.179	0.364	7.954E-10	212	0.080	0.203	5c7kF.pdb.gz	Complete epitopes for vaccine design derived from a crystal structure of the broadly neutralizing antibodies PGT128 and 8ANC195 in complex with an HIV-1 Env trimer.
17	PDB:1hzhH	0.218	0.241	1.277E-9	457	0.113	0.133	1hzhH.pdb.gz	Crystal structure of a neutralizing human IGG against HIV-1: a template for vaccine design.
18	PDB:1igtB	0.203	0.231	1.418E-9	444	0.117	0.142	1igtB.pdb.gz	Refined structure of an intact IgG2a monoclonal antibody.
19	PDB:1gafL	0.186	0.375	1.944E-9	214	0.076	0.192	1gafL.pdb.gz	The immunological evolution of catalysis.
20	PDB:3o3uN	0.269	0.251	4.060E-9	580	0.072	0.067	3o3uN.pdb.gz	The 1.5 A crystal structure of human receptor for advanced glycation endproducts (RAGE) ectodomains reveals unique features determining ligand binding.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P32507	0.0	704	530	0.740	0.751	NECT2_MOUSE Nectin-2 OS=Mus musculus OX=10090 GN=Nectin2 PE=1 SV=2
2	Q92692	0.0	1097	538	1.000	1.000	NECT2_HUMAN Nectin-2 OS=Homo sapiens OX=9606 GN=NECTIN2 PE=1 SV=1
3	P15151	1.71e-106	327	417	0.331	0.427	PVR_HUMAN Poliovirus receptor OS=Homo sapiens OX=9606 GN=PVR PE=1 SV=2
4	Q8BVF6	3.94e-89	281	408	0.316	0.417	Q8BVF6_MOUSE Ig-like domain-containing protein OS=Mus musculus OX=10090 GN=Pvr PE=2 SV=1
5	Q91WP1	4.34e-89	281	408	0.316	0.417	Q91WP1_MOUSE Cd155 OS=Mus musculus OX=10090 GN=Pvr PE=2 SV=1
6	Q8K094	1.28e-88	280	408	0.314	0.414	Q8K094_MOUSE Poliovirus receptor OS=Mus musculus OX=10090 GN=Pvr PE=1 SV=1
7	Q60977	4.03e-84	269	415	0.301	0.390	Q60977_MOUSE Tumor-associated glycoprotein E4 OS=Mus musculus OX=10090 GN=Pvr PE=2 SV=1
8	B0CLW6	3.55e-63	211	328	0.217	0.357	B0CLW6_DANRE PVR cell adhesion molecule related 2 like precursor OS=Danio rerio OX=7955 GN=si:dkey-225e11.1 PE=1 SV=1
9	A0A8I5ZLI7	2.13e-61	210	447	0.270	0.324	A0A8I5ZLI7_RAT Nectin cell adhesion molecule 1 OS=Rattus norvegicus OX=10116 GN=Nectin1 PE=1 SV=1
10	Q9JKF6	1.24e-57	202	515	0.249	0.260	NECT1_MOUSE Nectin-1 OS=Mus musculus OX=10090 GN=Nectin1 PE=1 SV=3
11	Q9GL76	1.70e-57	202	515	0.253	0.264	NECT1_PIG Nectin-1 OS=Sus scrofa OX=9823 GN=NECTIN1 PE=1 SV=1
12	F1LNP8	1.96e-56	199	515	0.247	0.258	F1LNP8_RAT Nectin cell adhesion molecule 1 OS=Rattus norvegicus OX=10116 GN=Nectin1 PE=1 SV=2
13	Q15223	8.80e-54	192	517	0.236	0.246	NECT1_HUMAN Nectin-1 OS=Homo sapiens OX=9606 GN=NECTIN1 PE=1 SV=3
14	A0A8I6APZ5	9.35e-47	171	438	0.212	0.260	A0A8I6APZ5_RAT Nectin cell adhesion molecule 3 OS=Rattus norvegicus OX=10116 GN=Nectin3 PE=3 SV=1
15	D4A5C0	1.51e-38	150	528	0.177	0.180	D4A5C0_RAT Nectin cell adhesion molecule 3 OS=Rattus norvegicus OX=10116 GN=Nectin3 PE=1 SV=2
16	A0A8I5ZU75	1.85e-38	150	549	0.180	0.177	A0A8I5ZU75_RAT Nectin cell adhesion molecule 3 OS=Rattus norvegicus OX=10116 GN=Nectin3 PE=3 SV=1
17	Q9NQS3	7.79e-37	145	549	0.173	0.169	NECT3_HUMAN Nectin-3 OS=Homo sapiens OX=9606 GN=NECTIN3 PE=1 SV=1
18	Q9JLB9	1.78e-36	144	549	0.171	0.168	NECT3_MOUSE Nectin-3 OS=Mus musculus OX=10090 GN=Nectin3 PE=1 SV=1
19	K4PZ75	3.49e-22	102	510	0.158	0.167	K4PZ75_HUMAN Ig superfamily receptor LNIR OS=Homo sapiens OX=9606 GN=LNIR PE=2 SV=1
20	Q96NY8	3.49e-22	102	510	0.158	0.167	NECT4_HUMAN Nectin-4 OS=Homo sapiens OX=9606 GN=NECTIN4 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04519 Bactofilin	1.7e+02	13.9	Polymer-forming cytoskeletal
2	PF07654 C1-set	3.6e+02	12.9	Immunoglobulin C1-set domain
3	PF08205 C2-set_2	6.5e-14	63.1	CD80-like C2-set immunoglobulin domain
4	PF07679 I-set	0.0022	29.4	Immunoglobulin I-set domain
5	PF00047 ig	5.9e-12	56.9	Immunoglobulin domain
6	PF13895 Ig_2	0.0062	28.2	Immunoglobulin domain
7	PF13927 Ig_3	2.9e-11	55.1	Immunoglobulin domain
8	PF16706 Izumo-Ig	6.4e+02	11.7	Izumo-like Immunoglobulin domain
9	PF03544 TonB_C	1.9e+02	14.0	Gram-negative bacterial TonB protein C-terminal
10	PF07686 V-set	1.6e-06	39.6	Immunoglobulin V-set domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000252483

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000280200	0.999	CD226 antigen
2	9606.ENSP00000419085	0.999	T-cell immunoreceptor with Ig and ITIM domains
3	9606.ENSP00000375960	0.998	Afadin
4	9606.ENSP00000418070	0.985	Nectin-3
5	9606.ENSP00000261769	0.933	Cadherin-1
6	9606.ENSP00000344456	0.930	Catenin beta-1
7	9606.ENSP00000316675	0.921	Transmembrane protein PVRIG
8	9606.ENSP00000304669	0.915	Catenin alpha-1
9	9606.ENSP00000283285	0.905	T-cell surface protein tactile
10	9606.ENSP00000253861	0.900	Exocyst complex component 4
11	9606.ENSP00000425587	0.900	Exocyst complex component 3
12	9606.ENSP00000227348	0.871	Cytotoxic and regulatory T-cell molecule
13	9606.ENSP00000269141	0.836	Cadherin-2
14	9606.ENSP00000363921	0.815	Partitioning defective 3 homolog
15	9606.ENSP00000480609	0.781	annotation not available
16	9606.ENSP00000347948	0.767	Tumor necrosis factor receptor superfamily member 14
17	9606.ENSP00000240618	0.763	Killer cell lectin-like receptor subfamily K, member 1
18	9606.ENSP00000229708	0.760	UL16-binding protein 1
19	9606.ENSP00000356991	0.732	Nectin-4
20	9606.ENSP00000356320	0.731	UL16-binding protein 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0050839	1.000	cell adhesion molecule binding
GO:0042803	1.000	protein homodimerization activity
GO:0060089	0.993	molecular transducer activity
GO:0038023	0.975	signaling receptor activity
GO:0015026	0.610	coreceptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.991	cellular process
GO:0050794	0.979	regulation of cellular process
GO:0098609	0.935	cell-cell adhesion
GO:0050865	0.901	regulation of cell activation
GO:0002697	0.897	regulation of immune effector process
GO:0048518	0.878	positive regulation of biological process
GO:0002703	0.875	regulation of leukocyte mediated immunity
GO:0031341	0.865	regulation of cell killing
GO:0042269	0.864	regulation of natural killer cell mediated cytotoxicity
GO:0002699	0.858	positive regulation of immune effector process
GO:0002708	0.849	positive regulation of lymphocyte mediated immunity
GO:0031343	0.846	positive regulation of cell killing
GO:0002833	0.846	positive regulation of response to biotic stimulus
GO:0002717	0.843	positive regulation of natural killer cell mediated immunity
GO:0002694	0.812	regulation of leukocyte activation
GO:0001912	0.771	positive regulation of leukocyte mediated cytotoxicity
GO:0045954	0.762	positive regulation of natural killer cell mediated cytotoxicity
GO:0071840	0.759	cellular component organization or biogenesis
GO:0016043	0.752	cellular component organization
GO:0050896	0.723	response to stimulus
GO:0002821	0.717	positive regulation of adaptive immune response
GO:0001914	0.716	regulation of T cell mediated cytotoxicity
GO:0044419	0.639	biological process involved in interspecies interaction between organisms
GO:0002824	0.606	positive regulation of adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains
GO:0023051	0.604	regulation of signaling
GO:0010646	0.604	regulation of cell communication
GO:0007156	0.575	homophilic cell adhesion via plasma membrane adhesion molecules
GO:0051240	0.569	positive regulation of multicellular organismal process
GO:0009966	0.555	regulation of signal transduction
GO:0032501	0.553	multicellular organismal process
GO:0050792	0.520	regulation of viral process
GO:0002712	0.515	regulation of B cell mediated immunity
GO:0043903	0.510	regulation of biological process involved in symbiotic interaction
GO:0002711	0.459	positive regulation of T cell mediated immunity
GO:0033003	0.449	regulation of mast cell activation
GO:0044403	0.416	biological process involved in symbiotic interaction
GO:1903900	0.390	regulation of viral life cycle
GO:0032502	0.355	developmental process
GO:0048856	0.352	anatomical structure development
GO:0002889	0.341	regulation of immunoglobulin mediated immune response
GO:0048519	0.333	negative regulation of biological process
GO:0019222	0.331	regulation of metabolic process
GO:0060255	0.315	regulation of macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0070161	0.998	anchoring junction
GO:0005911	0.983	cell-cell junction
GO:0005576	0.980	extracellular region
GO:0043226	0.941	organelle
GO:0043227	0.919	membrane-bounded organelle
GO:0005615	0.918	extracellular space
GO:0031982	0.903	vesicle
GO:0065010	0.876	extracellular membrane-bounded organelle
GO:0070062	0.874	extracellular exosome
GO:0009986	0.794	cell surface
GO:0005622	0.711	intracellular anatomical structure
GO:0030055	0.510	cell-substrate junction
GO:0005925	0.494	focal adhesion
GO:0005737	0.389	cytoplasm
GO:0043229	0.305	intracellular organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]