StarFunc result for job id Q92729

User Input

>input (1446 residues)
MARAQALVLALTFQLCAPETETPAAGCTFEEASDPAVPCEYSQAQYDDFQWEQVRIHPGT
RAPADLPHGSYLMVNTSQHAPGQRAHVIFQSLSENDTHCVQFSYFLYSRDGHSPGTLGVY
VRVNGGPLGSAVWNMTGSHGRQWHQAELAVSTFWPNEYQVLFEALISPDRRGYMGLDDIL
LLSYPCAKAPHFSRLGDVEVNAGQNASFQCMAAGRAAEAERFLLQRQSGALVPAAGVRHI
SHRRFLATFPLAAVSRAEQDLYRCVSQAPRGAGVSNFAELIVKEPPTPIAPPQLLRAGPT
YLIIQLNTNSIIGDGPIVRKEIEYRMARGPWAEVHAVSLQTYKLWHLDPDTEYEISVLLT
RPGDGGTGRPGPPLISRTKCAEPMRAPKGLAFAEIQARQLTLQWEPLGYNVTRCHTYTVS
LCYHYTLGSSHNQTIRECVKTEQGVSRYTIKNLLPYRNVHVRLVLTNPEGRKEGKEVTFQ
TDEDVPSGIAAESLTFTPLEDMIFLKWEEPQEPNGLITQYEISYQSIESSDPAVNVPGPR
RTISKLRNETYHVFSNLHPGTTYLFSVRARTGKGFGQAALTEITTNISAPSFDYADMPSP
LGESENTITVLLRPAQGRGAPISVYQVIVEEERARRLRREPGGQDCFPVPLTFEAALARG
LVHYFGAELAASSLPEAMPFTVGDNQTYRGFWNPPLEPRKAYLIYFQAASHLKGETRLNC
IRIARKAACKESKRPLEVSQRSEEMGLILGICAGGLAVLILLLGAIIVIIRKGRDHYAYS
YYPKPVNMTKATVNYRQEKTHMMSAVDRSFTDQSTLQEDERLGLSFMDTHGYSTRGDQRS
GGVTEASSLLGGSPRRPCGRKGSPYHTGQLHPAVRVADLLQHINQMKTAEGYGFKQEYES
FFEGWDATKKKDKVKGSRQEPMPAYDRHRVKLHPMLGDPNADYINANYIDGYHRSNHFIA
TQGPKPEMVYDFWRMVWQEHCSSIVMITKLVEVGRVKCSRYWPEDSDTYGDIKIMLVKTE
TLAEYVVRTFALERRGYSARHEVRQFHFTAWPEHGVPYHATGLLAFIRRVKASTPPDAGP
IVIHCSAGTGRTGCYIVLDVMLDMAECEGVVDIYNCVKTLCSRRVNMIQTEEQYIFIHDA
ILEACLCGETTIPVSEFKATYKEMIRIDPQSNSSQLREEFQTLNSVTPPLDVEECSIALL
PRNRDKNRSMDVLPPDRCLPFLISTDGDSNNYINAALTDSYTRSAAFIVTLHPLQSTTPD
FWRLVYDYGCTSIVMLNQLNQSNSAWPCLQYWPEPGRQQYGLMEVEFMSGTADEDLVARV
FRVQNISRLQEGHLLVRHFQFLRWSAYRDTPDSKKAFLHLLAEVDKWQAESGDGRTIVHC
LNGGGRSGTFCACATVLEMIRCHNLVDVFFAAKTLRNYKPNMVETMDQYHFCYDVALEYL
EGLESR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:B1AUH1	0.707	0.707	0.000	1446	0.952	0.952	B1AUH1.pdb.gz	PTPRU_MOUSE Receptor-type tyrosine-protein phosphatase U OS=Mus musculus OX=10090 GN=Ptpru PE=1 SV=1
2	AFDB:B3DK56	0.503	0.504	0.000	1444	0.750	0.751	B3DK56.pdb.gz	PTPRU_DANRE Receptor-type tyrosine-protein phosphatase U OS=Danio rerio OX=7955 GN=ptpru PE=2 SV=1
3	AFDB:F1LXJ9	0.388	0.441	0.000	1269	0.474	0.540	F1LXJ9.pdb.gz	F1LXJ9_RAT protein-tyrosine-phosphatase OS=Rattus norvegicus OX=10116 GN=Ptprt PE=1 SV=3
4	AFDB:P28827	0.629	0.627	0.000	1452	0.524	0.522	P28827.pdb.gz	PTPRM_HUMAN Receptor-type tyrosine-protein phosphatase mu OS=Homo sapiens OX=9606 GN=PTPRM PE=1 SV=2
5	AFDB:P35822	0.512	0.509	0.000	1457	0.582	0.577	P35822.pdb.gz	PTPRK_MOUSE Receptor-type tyrosine-protein phosphatase kappa OS=Mus musculus OX=10090 GN=Ptprk PE=1 SV=1
6	AFDB:P23468	0.377	0.286	1.380E-88	1912	0.263	0.199	P23468.pdb.gz	PTPRD_HUMAN Receptor-type tyrosine-protein phosphatase delta OS=Homo sapiens OX=9606 GN=PTPRD PE=1 SV=2
7	AFDB:P16621	0.379	0.272	9.011E-87	2029	0.246	0.175	P16621.pdb.gz	LAR_DROME Tyrosine-protein phosphatase Lar OS=Drosophila melanogaster OX=7227 GN=Lar PE=1 SV=2
8	AFDB:B0V2N1	0.375	0.285	9.134E-86	1907	0.259	0.196	B0V2N1.pdb.gz	PTPRS_MOUSE Receptor-type tyrosine-protein phosphatase S OS=Mus musculus OX=10090 GN=Ptprs PE=1 SV=1
9	AFDB:P16620	0.380	0.376	3.070E-81	1462	0.201	0.198	P16620.pdb.gz	PTP69_DROME Tyrosine-protein phosphatase 69D OS=Drosophila melanogaster OX=7227 GN=Ptp69D PE=1 SV=2
10	AFDB:A0A286Y939	0.375	0.687	6.792E-67	780	0.190	0.353	A0A286Y939.pdb.gz
11	PDB:4gwfA	0.161	0.454	4.486E-22	497	0.073	0.211	4gwfA.pdb.gz
12	PDB:5xzrA	0.165	0.450	4.783E-21	519	0.073	0.202	5xzrA.pdb.gz	Allosteric Inhibitors of SHP2 with Therapeutic Potential for Cancer Treatment.
13	PDB:3ps5A	0.171	0.455	2.519E-20	529	0.068	0.185	3ps5A.pdb.gz	Crystal structure of human protein tyrosine phosphatase SHP-1 in the open conformation.
14	PDB:6krwA	0.182	0.807	9.585E-18	306	0.057	0.271	6krwA.pdb.gz
15	PDB:3m4uA	0.135	0.647	2.599E-14	285	0.052	0.263	3m4uA.pdb.gz
16	PDB:5oj2B	0.103	0.180	7.481E-14	692	0.061	0.127	5oj2B.pdb.gz
17	PDB:1e07A	0.102	0.193	5.208E-11	642	0.053	0.118	1e07A.pdb.gz
18	PDB:8eyyA	0.155	0.268	1.108E-10	775	0.039	0.074	8eyyA.pdb.gz
19	PDB:7q5zA	0.076	0.081	1.834E-10	1344	0.047	0.051	7q5zA.pdb.gz
20	PDB:6h03A	0.074	0.085	2.243E-10	1223	0.049	0.058	6h03A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0G2K3H0	2751	1430	0.927	0.937	A0A0G2K3H0_RAT protein-tyrosine-phosphatase OS=Rattus norvegicus OX=10116 GN=Ptpru PE=3 SV=2
2	A0A8I5ZW41	1539	1465	0.521	0.514	A0A8I5ZW41_RAT protein-tyrosine-phosphatase OS=Rattus norvegicus OX=10116 GN=Ptprt PE=3 SV=1
3	A0A8I6AFL3	1521	1455	0.517	0.513	A0A8I6AFL3_RAT protein-tyrosine-phosphatase OS=Rattus norvegicus OX=10116 GN=Ptprt PE=3 SV=1
4	A5HV10	906	709	0.299	0.609	A5HV10_RAT Receptor-like protein tyrosine phosphatase kappa (Fragment) OS=Rattus norvegicus OX=10116 GN=Ptprk PE=2 SV=1
5	A5I9F0	1783	1439	0.594	0.597	A5I9F0_RAT protein-tyrosine-phosphatase OS=Rattus norvegicus OX=10116 GN=Ptprk PE=2 SV=1
6	B1AUH1	2877	1446	0.953	0.953	PTPRU_MOUSE Receptor-type tyrosine-protein phosphatase U OS=Mus musculus OX=10090 GN=Ptpru PE=1 SV=1
7	B3DK56	2264	1444	0.751	0.752	PTPRU_DANRE Receptor-type tyrosine-protein phosphatase U OS=Danio rerio OX=7955 GN=ptpru PE=2 SV=1
8	E7EPS8	1581	1390	0.519	0.540	E7EPS8_HUMAN protein-tyrosine-phosphatase OS=Homo sapiens OX=9606 GN=PTPRM PE=1 SV=2
9	E9PGC5	1772	1472	0.593	0.583	E9PGC5_HUMAN protein-tyrosine-phosphatase OS=Homo sapiens OX=9606 GN=PTPRK PE=1 SV=1
10	F1LXJ9	1523	1454	0.517	0.514	F1LXJ9_RAT protein-tyrosine-phosphatase OS=Rattus norvegicus OX=10116 GN=Ptprt PE=1 SV=3
11	F1MAG7	2677	1380	0.903	0.946	F1MAG7_RAT protein-tyrosine-phosphatase OS=Rattus norvegicus OX=10116 GN=Ptpru PE=3 SV=2
12	O14522	1552	1441	0.519	0.520	PTPRT_HUMAN Receptor-type tyrosine-protein phosphatase T OS=Homo sapiens OX=9606 GN=PTPRT PE=1 SV=6
13	P28827	1608	1452	0.531	0.529	PTPRM_HUMAN Receptor-type tyrosine-protein phosphatase mu OS=Homo sapiens OX=9606 GN=PTPRM PE=1 SV=2
14	P28828	1615	1452	0.537	0.535	PTPRM_MOUSE Receptor-type tyrosine-protein phosphatase mu OS=Mus musculus OX=10090 GN=Ptprm PE=1 SV=2
15	P35822	1772	1457	0.595	0.590	PTPRK_MOUSE Receptor-type tyrosine-protein phosphatase kappa OS=Mus musculus OX=10090 GN=Ptprk PE=1 SV=1
16	Q15262	1783	1439	0.593	0.596	PTPRK_HUMAN Receptor-type tyrosine-protein phosphatase kappa OS=Homo sapiens OX=9606 GN=PTPRK PE=1 SV=2
17	Q5TG12	1769	1458	0.593	0.588	Q5TG12_HUMAN protein-tyrosine-phosphatase OS=Homo sapiens OX=9606 GN=PTPRK PE=1 SV=1
18	Q92729	3024	1446	1.000	1.000	PTPRU_HUMAN Receptor-type tyrosine-protein phosphatase U OS=Homo sapiens OX=9606 GN=PTPRU PE=1 SV=2
19	Q99M80	1516	1454	0.514	0.511	PTPRT_MOUSE Receptor-type tyrosine-protein phosphatase T OS=Mus musculus OX=10090 GN=Ptprt PE=1 SV=2
20	Q9WUL3	595	502	0.189	0.544	Q9WUL3_RAT Receptor-like protein tyrosine phosphatase kappa extracellular region OS=Rattus norvegicus OX=10116 GN=RPTPK PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00782 DSPc	0.0076	27.5	Dual specificity phosphatase, catalytic domain
2	PF00041 fn3	1.6e-26	103.8	Fibronectin type III domain
3	PF00629 MAM	3.2e-32	123.0	MAM domain, meprin/A5/mu
4	PF14566 PTPlike_phytase	0.93	21.1	Inositol hexakisphosphate
5	PF16656 Pur_ac_phosph_N	16	17.6	Purple acid Phosphatase, N-terminal domain
6	PF00102 Y_phosphatase	4.8e-131	447.0	Protein-tyrosine phosphatase
7	PF13350 Y_phosphatase3	0.37	22.4	Tyrosine phosphatase family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000334941

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000288135	0.917	Mast/stem cell growth factor receptor Kit
2	9606.ENSP00000344456	0.818	Catenin beta-1
3	9606.ENSP00000269202	0.764	Meprin A subunit beta
4	9606.ENSP00000387046	0.719	Protein phosphatase, Mg2+/Mn2+ dependent 1M
5	9606.ENSP00000357040	0.690	Vang-like protein 2
6	9606.ENSP00000280362	0.671	6-pyruvoyl tetrahydrobiopterin synthase
7	9606.ENSP00000262738	0.666	Cadherin EGF LAG seven-pass G-type receptor 1
8	9606.ENSP00000412869	0.636	Zinc finger protein Helios
9	9606.ENSP00000347672	0.614	VANGL planar cell polarity protein 1
10	9606.ENSP00000356587	0.567	Podocin
11	9606.ENSP00000349932	0.559	Receptor-type tyrosine-protein phosphatase S
12	9606.ENSP00000368190	0.557	Nephrin
13	9606.ENSP00000323511	0.552	Bifunctional polynucleotide phosphatase/kinase
14	9606.ENSP00000334928	0.547	Receptor-type tyrosine-protein phosphatase beta
15	9606.ENSP00000353030	0.543	Receptor-type tyrosine-protein phosphatase F
16	9606.ENSP00000394794	0.537	Tyrosine-protein phosphatase non-receptor type 13
17	9606.ENSP00000376345	0.525	Growth factor receptor-bound protein 2
18	9606.ENSP00000352821	0.518	Probable palmitoyltransferase ZDHHC14
19	9606.ENSP00000360431	0.514	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase epsilon-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008013	1.000	beta-catenin binding
GO:0004725	0.999	protein tyrosine phosphatase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.990	cellular process
GO:0050794	0.963	regulation of cellular process
GO:0050896	0.854	response to stimulus
GO:0032502	0.829	developmental process
GO:0071704	0.825	organic substance metabolic process
GO:0048856	0.816	anatomical structure development
GO:0044237	0.751	cellular metabolic process
GO:0044238	0.733	primary metabolic process
GO:0006807	0.631	nitrogen compound metabolic process
GO:0043170	0.599	macromolecule metabolic process
GO:0043412	0.561	macromolecule modification
GO:1901564	0.550	organonitrogen compound metabolic process
GO:0036211	0.540	protein modification process
GO:0048523	0.505	negative regulation of cellular process
GO:0007155	0.486	cell adhesion
GO:0032501	0.485	multicellular organismal process
GO:0006796	0.422	phosphate-containing compound metabolic process
GO:0048518	0.347	positive regulation of biological process
GO:0006470	0.336	protein dephosphorylation
GO:0051716	0.333	cellular response to stimulus
GO:0048522	0.331	positive regulation of cellular process
GO:0051179	0.324	localization
GO:0048583	0.319	regulation of response to stimulus
GO:0009966	0.313	regulation of signal transduction
GO:0042221	0.312	response to chemical

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.998	plasma membrane
GO:0030054	0.978	cell junction
GO:0043226	0.950	organelle
GO:0043227	0.848	membrane-bounded organelle
GO:0005622	0.843	intracellular anatomical structure
GO:0043231	0.768	intracellular membrane-bounded organelle
GO:0005911	0.416	cell-cell junction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:10684	0.999	H2O + O-phospho-L-tyrosyl-[protein] = L-tyrosyl-[protein] + phosphate
EC:3.1.3.48	0.999	protein-tyrosine-phosphatase.

[back to server]