StarFunc result for job id Q92731

User Input

>input (530 residues)
MDIKNSPSSLNSPSSYNCSQSILPLEHGSIYIPSSYVDSHHEYPAMTFYSPAVMNYSIPS
NVTNLEGGPGRQTTSPNVLWPTPGHLSPLVVHRQLSHLYAEPQKSPWCEARSLEHTLPVN
RETLKRKVSGNRCASPVTGPGSKRDAHFCAVCSDYASGYHYGVWSCEGCKAFFKRSIQGH
NDYICPATNQCTIDKNRRKSCQACRLRKCYEVGMVKCGSRRERCGYRLVRRQRSADEQLH
CAGKAKRSGGHAPRVRELLLDALSPEQLVLTLLEAEPPHVLISRPSAPFTEASMMMSLTK
LADKELVHMISWAKKIPGFVELSLFDQVRLLESCWMEVLMMGLMWRSIDHPGKLIFAPDL
VLDRDEGKCVEGILEIFDMLLATTSRFRELKLQHKEYLCVKAMILLNSSMYPLVTATQDA
DSSRKLAHLLNAVTDALVWVIAKSGISSQQQSMRLANLLMLLSHVRHASNKGMEHLLNMK
CKNVVPVYDLLLEMLNAHVLRGCKSSITGSECSPAEDSKSKEGSQNPQSQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q7LCB3	0.625	0.625	9.042E-68	530	1.000	1.000	Q7LCB3.pdb.gz	Q7LCB3_HUMAN Estrogen receptor beta OS=Homo sapiens OX=9606 GN=NR3A2 PE=2 SV=1
2	AFDB:O08537	0.724	0.724	4.650E-64	530	0.887	0.887	O08537.pdb.gz	ESR2_MOUSE Estrogen receptor beta OS=Mus musculus OX=10090 GN=Esr2 PE=1 SV=3
3	AFDB:P57717	0.512	0.480	1.507E-40	569	0.481	0.448	P57717.pdb.gz	ESR1_DANRE Estrogen receptor OS=Danio rerio OX=7955 GN=esr1 PE=2 SV=2
4	AFDB:P16058	0.570	0.492	3.508E-38	622	0.483	0.412	P16058.pdb.gz	ESR1_ONCMY Estrogen receptor OS=Oncorhynchus mykiss OX=8022 GN=esr1 PE=2 SV=3
5	AFDB:Q9YHZ7	0.466	0.410	3.674E-38	617	0.468	0.402	Q9YHZ7.pdb.gz	ESR1_ICTPU Estrogen receptor OS=Ictalurus punctatus OX=7998 GN=esr1 PE=2 SV=2
6	AFDB:F6PD98	0.396	0.418	1.390E-25	501	0.279	0.295	F6PD98.pdb.gz	F6PD98_DANRE Estrogen-related receptor gamma a OS=Danio rerio OX=7955 GN=errg PE=3 SV=1
7	AFDB:Q9I8F5	0.422	0.271	5.208E-21	839	0.247	0.156	Q9I8F5.pdb.gz	Q9I8F5_PIMPR Androgen receptor OS=Pimephales promelas OX=90988 PE=2 SV=2
8	AFDB:D0EWS6	0.414	0.239	9.065E-21	934	0.243	0.138	D0EWS6.pdb.gz	D0EWS6_PIG Progesterone receptor OS=Sus scrofa OX=9823 GN=PGR PE=2 SV=1
9	AFDB:P07812	0.429	0.293	1.507E-20	786	0.242	0.163	P07812.pdb.gz	PRGR_CHICK Progesterone receptor OS=Gallus gallus OX=9031 GN=PGR PE=1 SV=1
10	AFDB:P06536	0.421	0.284	2.504E-20	795	0.234	0.156	P06536.pdb.gz	GCR_RAT Glucocorticoid receptor OS=Rattus norvegicus OX=10116 GN=Nr3c1 PE=1 SV=2
11	PDB:3dzyA	0.435	0.713	3.452E-16	302	0.189	0.331	3dzyA.pdb.gz	Structure of the intact PPAR-gamma-RXR- nuclear receptor complex on DNA.
12	PDB:6fx0A	0.372	0.790	2.504E-9	238	0.100	0.223	6fx0A.pdb.gz	Structure-based design of Trifarotene (CD5789), a potent and selective RAR gamma agonist for the treatment of acne.
13	PDB:1g2nA	0.354	0.724	3.624E-9	246	0.115	0.248	1g2nA.pdb.gz	Crystal structure of the ligand-binding domain of the ultraspiracle protein USP, the ortholog of retinoid X receptors in insects.
14	PDB:7kw7F	0.347	0.682	4.162E-9	259	0.119	0.243	7kw7F.pdb.gz	Structure of Hsp90-Hsp70-Hop-GR reveals the Hsp90 client-loading mechanism.
15	PDB:7wq3R	0.107	0.163	3.468E-2	289	0.077	0.142	7wq3R.pdb.gz	Molecular basis for allosteric agonism and G protein subtype selectivity of galanin receptors
16	PDB:2jcdA	0.124	0.167	1.829E-1	315	0.077	0.130	2jcdA.pdb.gz	Structure and Action of the N-Oxygenase Aurf from Streptomyces Thioluteus.
17	PDB:4im0A	0.077	0.069	2.006E-1	619	0.077	0.066	4im0A.pdb.gz	Structure and ubiquitination-dependent activation of TANK-binding kinase 1.
18	PDB:6o8bB	0.072	0.063	2.101E-1	657	0.079	0.064	6o8bB.pdb.gz	A conserved PLPLRT/SD motif of STING mediates the recruitment and activation of TBK1.
19	PDB:6o8cA	0.078	0.068	2.528E-1	636	0.081	0.068	6o8cA.pdb.gz	A conserved PLPLRT/SD motif of STING mediates the recruitment and activation of TBK1.
20	PDB:5ogeG	0.099	0.154	3.335E-1	306	0.042	0.072	5ogeG.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A348FV93	0.0	974	474	0.883	0.987	A0A348FV93_HUMAN Estrogen receptor beta OS=Homo sapiens OX=9606 GN=ESR2 PE=2 SV=1
2	F1D8N3	0.0	980	495	0.891	0.954	F1D8N3_HUMAN Estrogen receptor beta OS=Homo sapiens OX=9606 GN=NR3A2 PE=2 SV=1
3	G3V5S2	0.0	977	513	0.889	0.918	G3V5S2_HUMAN Estrogen receptor beta OS=Homo sapiens OX=9606 GN=ESR2 PE=1 SV=2
4	H0ZRT6	0.0	814	554	0.745	0.713	H0ZRT6_TAEGU Estrogen receptor 2 OS=Taeniopygia guttata OX=59729 GN=ESR2 PE=3 SV=2
5	O08537	0.0	983	530	0.887	0.887	ESR2_MOUSE Estrogen receptor beta OS=Mus musculus OX=10090 GN=Esr2 PE=1 SV=3
6	P57782	0.0	554	568	0.545	0.509	ESR2_ONCMY Estrogen receptor beta OS=Oncorhynchus mykiss OX=8022 GN=esr2 PE=2 SV=1
7	Q62986	0.0	941	530	0.883	0.883	ESR2_RAT Estrogen receptor beta OS=Rattus norvegicus OX=10116 GN=Esr2 PE=1 SV=2
8	Q7LCB3	0.0	1101	530	1.000	1.000	Q7LCB3_HUMAN Estrogen receptor beta OS=Homo sapiens OX=9606 GN=NR3A2 PE=2 SV=1
9	Q7ZU32	0.0	558	553	0.551	0.528	Q7ZU32_DANRE Esr2a protein OS=Danio rerio OX=7955 GN=ER[b]2 PE=2 SV=1
10	Q92731	0.0	1101	530	1.000	1.000	ESR2_HUMAN Estrogen receptor beta OS=Homo sapiens OX=9606 GN=ESR2 PE=1 SV=2
11	Q5PR29	6.49e-177	513	592	0.534	0.478	Q5PR29_DANRE Esr2b protein OS=Danio rerio OX=7955 GN=ER[b]1 PE=2 SV=1
12	B8JJL3	1.91e-176	511	592	0.534	0.478	B8JJL3_DANRE Estrogen receptor 2b OS=Danio rerio OX=7955 GN=ER[b]1 PE=3 SV=1
13	Q9IAK1	8.53e-174	504	575	0.536	0.494	ESR2_ICTPU Estrogen receptor beta OS=Ictalurus punctatus OX=7998 GN=esr2 PE=2 SV=1
14	W5UDK8	1.57e-173	503	575	0.534	0.492	W5UDK8_ICTPU Estrogen receptor beta OS=Ictalurus punctatus OX=7998 GN=esr2 PE=2 SV=1
15	E5L8C9	2.62e-165	483	589	0.460	0.414	E5L8C9_CHICK Estrogen receptor OS=Gallus gallus OX=9031 PE=2 SV=1
16	Q8AYH0	5.48e-165	482	589	0.458	0.413	Q8AYH0_COTJA Estrogen receptor OS=Coturnix japonica OX=93934 GN=ESR1 PE=2 SV=1
17	P06212	1.69e-164	481	589	0.458	0.413	ESR1_CHICK Estrogen receptor OS=Gallus gallus OX=9031 GN=ESR1 PE=2 SV=1
18	Q91250	5.02e-164	479	587	0.428	0.387	ESR1_TAEGU Estrogen receptor OS=Taeniopygia guttata OX=59729 GN=ESR1 PE=2 SV=1
19	H0ZLY1	3.30e-163	479	621	0.428	0.366	H0ZLY1_TAEGU Estrogen receptor OS=Taeniopygia guttata OX=59729 GN=ESR1 PE=3 SV=2
20	G4XH65	2.62e-159	468	595	0.466	0.415	G4XH65_HUMAN Estrogen receptor OS=Homo sapiens OX=9606 GN=ESR1 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12497 ERbeta_N	5.5e-50	179.4	Estrogen receptor beta
2	PF00104 Hormone_recep	4.2e-30	116.5	Ligand-binding domain of nuclear hormone receptor
3	PF00105 zf-C4	7e-28	108.2	Zinc finger, C4 type (two domains)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000343925

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000361066	0.999	Nuclear receptor coactivator 3
2	9606.ENSP00000385216	0.999	Nuclear receptor coactivator 1
3	9606.ENSP00000399968	0.999	Nuclear receptor coactivator 2
4	9606.ENSP00000329357	0.995	Transcription factor Sp1
5	9606.ENSP00000339191	0.995	Caveolin-1
6	9606.ENSP00000362680	0.995	Proto-oncogene tyrosine-protein kinase Src
7	9606.ENSP00000405330	0.987	Estrogen receptor
8	9606.ENSP00000297494	0.984	Nitric oxide synthase, endothelial
9	9606.ENSP00000268712	0.980	Nuclear receptor corepressor 1
10	9606.ENSP00000300651	0.980	Mediator of RNA polymerase II transcription subunit 1
11	9606.ENSP00000306245	0.970	Proto-oncogene c-Fos
12	9606.ENSP00000323858	0.964	ATP-dependent RNA helicase DDX54
13	9606.ENSP00000335153	0.964	Heat shock protein HSP 90-alpha
14	9606.ENSP00000360266	0.958	Transcription factor AP-1
15	9606.ENSP00000254227	0.952	Nuclear receptor subfamily 0 group B member 2
16	9606.ENSP00000368253	0.947	Nuclear receptor subfamily 0 group B member 1
17	9606.ENSP00000333685	0.936	Mitogen-activated protein kinase 11
18	9606.ENSP00000340514	0.935	Zinc finger protein 14
19	9606.ENSP00000286548	0.933	Guanine nucleotide-binding protein G(q) subunit alpha
20	9606.ENSP00000383063	0.933	Nuclear receptor-interacting protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0038023	0.999	signaling receptor activity
GO:0005515	0.999	protein binding
GO:0003700	0.999	DNA-binding transcription factor activity
GO:0003677	0.996	DNA binding
GO:0003707	0.984	nuclear steroid receptor activity
GO:0000981	0.974	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0008289	0.924	lipid binding
GO:0030284	0.904	nuclear estrogen receptor activity
GO:0005496	0.780	steroid binding
GO:1903924	0.712	estradiol binding
GO:0098531	0.710	ligand-activated transcription factor activity
GO:0042562	0.666	hormone binding
GO:0004879	0.655	nuclear receptor activity
GO:1990239	0.522	steroid hormone binding
GO:0043565	0.383	sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.998	response to stimulus
GO:0009987	0.993	cellular process
GO:0050794	0.988	regulation of cellular process
GO:0051716	0.964	cellular response to stimulus
GO:0007154	0.949	cell communication
GO:0042221	0.938	response to chemical
GO:0007165	0.935	signal transduction
GO:0010033	0.927	response to organic substance
GO:0009719	0.909	response to endogenous stimulus
GO:0032870	0.840	cellular response to hormone stimulus
GO:0019222	0.827	regulation of metabolic process
GO:0014070	0.824	response to organic cyclic compound
GO:0048518	0.779	positive regulation of biological process
GO:0060255	0.775	regulation of macromolecule metabolic process
GO:0009755	0.770	hormone-mediated signaling pathway
GO:0071407	0.764	cellular response to organic cyclic compound
GO:0080090	0.762	regulation of primary metabolic process
GO:0033993	0.761	response to lipid
GO:0048545	0.747	response to steroid hormone
GO:0071383	0.735	cellular response to steroid hormone stimulus
GO:0031323	0.729	regulation of cellular metabolic process
GO:0051171	0.728	regulation of nitrogen compound metabolic process
GO:0043401	0.719	steroid hormone mediated signaling pathway
GO:0010468	0.657	regulation of gene expression
GO:0048522	0.635	positive regulation of cellular process
GO:0030522	0.625	intracellular receptor signaling pathway
GO:0032502	0.609	developmental process
GO:0030518	0.574	intracellular steroid hormone receptor signaling pathway
GO:0019219	0.568	regulation of nucleobase-containing compound metabolic process
GO:0010556	0.567	regulation of macromolecule biosynthetic process
GO:0031326	0.567	regulation of cellular biosynthetic process
GO:0006355	0.557	regulation of DNA-templated transcription
GO:0048856	0.487	anatomical structure development
GO:0048519	0.485	negative regulation of biological process
GO:0032501	0.476	multicellular organismal process
GO:0009893	0.468	positive regulation of metabolic process
GO:0048523	0.465	negative regulation of cellular process
GO:0010604	0.430	positive regulation of macromolecule metabolic process
GO:1901700	0.416	response to oxygen-containing compound
GO:0051173	0.410	positive regulation of nitrogen compound metabolic process
GO:0031325	0.406	positive regulation of cellular metabolic process
GO:0048583	0.403	regulation of response to stimulus
GO:0023051	0.379	regulation of signaling
GO:0010646	0.379	regulation of cell communication
GO:0008152	0.366	metabolic process
GO:0009966	0.363	regulation of signal transduction
GO:0071704	0.337	organic substance metabolic process
GO:0009891	0.302	positive regulation of biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.996	nucleoplasm
GO:0005737	0.961	cytoplasm
GO:0016020	0.442	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]