StarFunc result for job id Q92734

User Input

>input (400 residues)
MNGQLDLSGKLIIKAQLGEDIRRIPIHNEDITYDELVLMMQRVFRGKLLSNDEVTIKYKD
EDGDLITIFDSSDLSFAIQCSRILKLTLFVNGQPRPLESSQVKYLRRELIELRNKVNRLL
DSLEPPGEPGPSTNIPENDTVDGREEKSASDSSGKQSTQVMAASMSAFDPLKNQDEINKN
VMSAFGLTDDQVSGPPSAPAEDRSGTPDSIASSSSAAHPPGVQPQQPPYTGAQTQAGQIE
GQMYQQYQQQAGYGAQQPQAPPQQPQQYGIQYSASYSQQTGPQQPQQFQGYGQQPTSQAP
APAFSGQPQQLPAQPPQQYQASNYPAQTYTAQTSQPTNYTVAPASQPGMAPSQPGAYQPR
PGFTSLPGSTMTPPPSGPNPYARNRPPFGQGYTQPGPGYR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q92734	0.999	0.999	7.682E-60	400	1.000	1.000	Q92734.pdb.gz	TFG_HUMAN Protein TFG OS=Homo sapiens OX=9606 GN=TFG PE=1 SV=2
2	AFDB:Q05BK6	0.293	0.317	3.041E-37	366	0.608	0.664	Q05BK6.pdb.gz	Q05BK6_HUMAN TFG protein OS=Homo sapiens OX=9606 GN=TFG PE=1 SV=1
3	AFDB:Q9U1W1	0.203	0.171	1.169E-11	486	0.260	0.214	Q9U1W1.pdb.gz	TFG_CAEEL Protein tfg-1 OS=Caenorhabditis elegans OX=6239 GN=tfg-1 PE=1 SV=1
4	AFDB:Q38CG8	0.185	0.073	1.252E-5	1083	0.150	0.055	Q38CG8.pdb.gz	Q38CG8_TRYB2 PB1 domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.7490 PE=4 SV=1
5	PDB:2dybA	0.166	0.217	1.776E-4	298	0.043	0.057	2dybA.pdb.gz
6	AFDB:Q54JN7	0.151	0.105	1.936E-4	604	0.133	0.088	Q54JN7.pdb.gz	Q54JN7_DICDI Ubiquitin domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DG1037 PE=4 SV=1
7	AFDB:Q9LRY7	0.167	0.068	2.043E-3	1117	0.190	0.068	Q9LRY7.pdb.gz	Q9LRY7_ARATH Kinase superfamily with octicosapeptide/Phox/Bem1p domain-containing protein OS=Arabidopsis thaliana OX=3702 GN=HCR1 PE=1 SV=1
8	PDB:4rm8A	0.179	0.194	3.777E-3	368	0.028	0.030	4rm8A.pdb.gz
9	PDB:7lswC	0.171	0.424	4.026E-3	145	0.028	0.076	7lswC.pdb.gz
10	PDB:6hivCv	0.187	0.073	9.819E-3	1059	0.022	0.008	6hivCv.pdb.gz	Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.
11	PDB:3wanB	0.146	0.411	1.046E-2	128	0.025	0.078	3wanB.pdb.gz
12	PDB:5swpA	0.156	0.064	1.046E-2	1060	0.040	0.015	5swpA.pdb.gz	Identification of allosteric binding sites for PI3K alpha oncogenic mutant specific inhibitor design.
13	PDB:7vvbB	0.161	0.684	1.046E-2	77	0.028	0.143	7vvbB.pdb.gz	Structural insights into Ras regulation by SIN1.
14	PDB:5dxtA	0.160	0.078	1.115E-2	879	0.025	0.011	5dxtA.pdb.gz	The Rational Design of Selective Benzoxazepin Inhibitors of the alpha-Isoform of Phosphoinositide 3-Kinase Culminating in the Identification of (S)-2-((2-(1-Isopropyl-1H-1,2,4-triazol-5-yl)-5,6-dihydrobenzo[f]imidazo[1,2-d][1,4]oxazepin-9-yl)oxy)propanamide (GDC-0326).
15	AFDB:B0S7K8	0.156	0.121	1.381E-2	532	0.133	0.100	B0S7K8.pdb.gz	B0S7K8_DANRE Coilin OS=Danio rerio OX=7955 GN=CLN80 PE=1 SV=1
16	PDB:1m4vB	0.111	0.186	1.439E-2	197	0.043	0.086	1m4vB.pdb.gz
17	PDB:5azfA	0.153	0.458	1.533E-2	119	0.020	0.067	5azfA.pdb.gz	Structural Basis of the Differential Function of the Two C. elegans Atg8 Homologs, LGG-1 and LGG-2, in Autophagy.
18	AFDB:Q8N3L3	0.088	0.057	2.610E-2	684	0.128	0.075	Q8N3L3.pdb.gz	TXLNB_HUMAN Beta-taxilin OS=Homo sapiens OX=9606 GN=TXLNB PE=1 SV=3
19	AFDB:Q5SU73	0.132	0.095	3.160E-2	570	0.158	0.111	Q5SU73.pdb.gz	COIL_MOUSE Coilin OS=Mus musculus OX=10090 GN=Coil PE=1 SV=1
20	AFDB:O14924	0.145	0.046	3.825E-2	1447	0.163	0.045	O14924.pdb.gz	RGS12_HUMAN Regulator of G-protein signaling 12 OS=Homo sapiens OX=9606 GN=RGS12 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q92734	0.0	792	400	1.000	1.000	TFG_HUMAN Protein TFG OS=Homo sapiens OX=9606 GN=TFG PE=1 SV=2
2	Q05BK6	5.61e-176	496	366	0.608	0.664	Q05BK6_HUMAN TFG protein OS=Homo sapiens OX=9606 GN=TFG PE=1 SV=1
3	C9JJP5	4.18e-131	375	181	0.453	1.000	C9JJP5_HUMAN Protein TFG (Fragment) OS=Homo sapiens OX=9606 GN=TFG PE=1 SV=1
4	C9JUE0	1.05e-111	325	157	0.393	1.000	C9JUE0_HUMAN Protein TFG (Fragment) OS=Homo sapiens OX=9606 GN=TFG PE=1 SV=1
5	Q9U1W1	6.90e-12	69.3	486	0.092	0.076	TFG_CAEEL Protein tfg-1 OS=Caenorhabditis elegans OX=6239 GN=tfg-1 PE=1 SV=1
6	Q9JKS6	0.34	35.8	5085	0.110	0.009	PCLO_RAT Protein piccolo OS=Rattus norvegicus OX=10116 GN=Pclo PE=1 SV=1
7	Q4TZQ4	2.4	32.7	831	0.048	0.023	Q4TZQ4_DROME TAK1-binding protein OS=Drosophila melanogaster OX=7227 GN=Tab2 PE=2 SV=1
8	Q6NQZ7	2.5	32.7	831	0.048	0.023	Q6NQZ7_DROME LD40663p OS=Drosophila melanogaster OX=7227 GN=Tab2 PE=2 SV=1
9	Q9NFL3	2.5	32.7	831	0.048	0.023	Q9NFL3_DROME Transcription factor OS=Drosophila melanogaster OX=7227 GN=Tab2 PE=2 SV=1
10	A0A0B4KG87	2.8	32.7	820	0.048	0.023	A0A0B4KG87_DROME TAK1-associated binding protein 2, isoform C OS=Drosophila melanogaster OX=7227 GN=Tab2 PE=4 SV=1
11	F1RCN2	4.2	32.3	1502	0.065	0.017	F1RCN2_DANRE CECR2 histone acetyl-lysine reader OS=Danio rerio OX=7955 GN=cecr2 PE=1 SV=1
12	Q4QRG0	9.9	30.8	579	0.100	0.069	Q4QRG0_DANRE EWS RNA-binding protein 1b OS=Danio rerio OX=7955 GN=fb40b11 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06458 MucBP	72	15.8	MucBP domain
2	PF00564 PB1	5.9e-08	43.9	PB1 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000240851

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000325827	0.977	Protein transport protein Sec16A
2	9606.ENSP00000378721	0.971	Protein transport protein Sec31A
3	9606.ENSP00000431418	0.922	High affinity nerve growth factor receptor
4	9606.ENSP00000357516	0.919	Tropomyosin alpha-3 chain
5	9606.ENSP00000356448	0.844	Nucleoprotein TPR
6	9606.ENSP00000373312	0.833	Protein SEC13 homolog
7	9606.ENSP00000323889	0.819	E3 ubiquitin/ISG15 ligase TRIM25
8	9606.ENSP00000216218	0.811	Hsc70-interacting protein
9	9606.ENSP00000343405	0.803	Protein transport protein Sec24C
10	9606.ENSP00000381823	0.801	Protein transport protein Sec24A
11	9606.ENSP00000253413	0.800	V-type proton ATPase subunit E 1
12	9606.ENSP00000320663	0.795	Echinoderm microtubule-associated protein-like 4
13	9606.ENSP00000324343	0.788	Beta-ureidopropionase
14	9606.ENSP00000373700	0.782	ALK tyrosine kinase receptor
15	9606.ENSP00000428564	0.772	Protein transport protein Sec24B
16	9606.ENSP00000327801	0.767	Protein disulfide-isomerase
17	9606.ENSP00000306881	0.765	Protein transport protein Sec23A
18	9606.ENSP00000280551	0.750	Protein transport protein Sec24D
19	9606.ENSP00000324173	0.729	78 kDa glucose-regulated protein
20	9606.ENSP00000308339	0.724	Protein transport protein Sec16B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042802	1.000	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.992	regulation of cellular process
GO:0009987	0.988	cellular process
GO:0009966	0.983	regulation of signal transduction
GO:0048522	0.982	positive regulation of cellular process
GO:0051179	0.981	localization
GO:0016192	0.958	vesicle-mediated transport
GO:0046907	0.955	intracellular transport
GO:1902531	0.954	regulation of intracellular signal transduction
GO:0048193	0.918	Golgi vesicle transport
GO:0006888	0.913	endoplasmic reticulum to Golgi vesicle-mediated transport
GO:1902533	0.900	positive regulation of intracellular signal transduction
GO:0043122	0.899	regulation of I-kappaB kinase/NF-kappaB signaling
GO:0043123	0.731	positive regulation of I-kappaB kinase/NF-kappaB signaling
GO:0050896	0.320	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0012505	0.999	endomembrane system
GO:0005829	0.999	cytosol
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0005783	0.994	endoplasmic reticulum
GO:0070971	0.884	endoplasmic reticulum exit site
GO:0016020	0.871	membrane
GO:0032991	0.660	protein-containing complex
GO:0031982	0.541	vesicle
GO:0043228	0.512	non-membrane-bounded organelle
GO:0070013	0.436	intracellular organelle lumen
GO:0031981	0.422	nuclear lumen
GO:0043232	0.413	intracellular non-membrane-bounded organelle
GO:0005654	0.396	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]