StarFunc result for job id Q92736

User Input

>input (1400 residues)
MADGGEGEDEIQFLRTDDEVVLQCTATIHKEQQKLCLAAEGFGNRLCFLESTSNSKNVPP
DLSICTFVLEQSLSVRALQEMLANTVEKSEGQVDVEKWKFMMKTAQGGGHRTLLYGHAIL
LRHSYSGMYLCCLSTSRSSTDKLAFDVGLQEDTTGEACWWTIHPASKQRSEGEKVRVGDD
LILVSVSSERYLHLSYGNGSLHVDAAFQQTLWSVAPISSGSEAAQGYLIGGDVLRLLHGH
MDECLTVPSGEHGEEQRRTVHYEGGAVSVHARSLWRLETLRVAWSGSHIRWGQPFRLRHV
TTGKYLSLMEDKNLLLMDKEKADVKSTAFTFRSSKEKLDVGVRKEVDGMGTSEIKYGDSV
CYIQHVDTGLWLTYQSVDVKSVRMGSIQRKAIMHHEGHMDDGISLSRSQHEESRTARVIR
STVFLFNRFIRGLDALSKKAKASTVDLPIESVSLSLQDLIGYFHPPDEHLEHEDKQNRLR
ALKNRQNLFQEEGMINLVLECIDRLHVYSSAAHFADVAGREAGESWKSILNSLYELLAAL
IRGNRKNCAQFSGSLDWLISRLERLEASSGILEVLHCVLVESPEALNIIKEGHIKSIISL
LDKHGRNHKVLDVLCSLCVCHGVAVRSNQHLICDNLLPGRDLLLQTRLVNHVSSMRPNIF
LGVSEGSAQYKKWYYELMVDHTEPFVTAEATHLRVGWASTEGYSPYPGGGEEWGGNGVGD
DLFSYGFDGLHLWSGCIARTVSSPNQHLLRTDDVISCCLDLSAPSISFRINGQPVQGMFE
NFNIDGLFFPVVSFSAGIKVRFLLGGRHGEFKFLPPPGYAPCYEAVLPKEKLKVEHSREY
KQERTYTRDLLGPTVSLTQAAFTPIPVDTSQIVLPPHLERIREKLAENIHELWVMNKIEL
GWQYGPVRDDNKRQHPCLVEFSKLPEQERNYNLQMSLETLKTLLALGCHVGISDEHAEDK
VKKMKLPKNYQLTSGYKPAPMDLSFIKLTPSQEAMVDKLAENAHNVWARDRIRQGWTYGI
QQDVKNRRNPRLVPYTLLDDRTKKSNKDSLREAVRTLLGYGYNLEAPDQDHAARAEVCSG
TGERFRIFRAEKTYAVKAGRWYFEFETVTAGDMRVGWSRPGCQPDQELGSDERAFAFDGF
KAQRWHQGNEHYGRSWQAGDVVGCMVDMNEHTMMFTLNGEILLDDSGSELAFKDFDVGDG
FIPVCSLGVAQVGRMNFGKDVSTLKYFTICGLQEGYEPFAVNTNRDITMWLSKRLPQFLQ
VPSNHEHIEVTRIDGTIDSSPCLKVTQKSFGSQNSNTDIMFYRLSMPIECAEVFSKTVAG
GLPGAGLFGPKNDLEDYDADSDFEVLMKTAHGHLVPDRVDKDKEATKPEFNNHKDYAQEK
PSRLKQRFLLRRTKPDYSTS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:3j8hA	0.772	0.301	0.000	3660	0.577	0.221	3j8hA.pdb.gz	Structure of the rabbit ryanodine receptor RyR1 at near-atomic resolution.
2	PDB:5gkyA	0.778	0.303	0.000	3660	0.576	0.220	5gkyA.pdb.gz	The Central domain of RyR1 is the transducer for long-range allosteric gating of channel opening
3	PDB:5t15B	0.851	0.290	0.000	4170	0.618	0.207	5t15B.pdb.gz	Structural Basis for Gating and Activation of RyR1.
4	PDB:6wotA	0.851	0.288	0.000	4197	0.617	0.206	6wotA.pdb.gz	Structural mechanism of two gain-of-function cardiac and skeletal RyR mutations at an equivalent site by cryo-EM.
5	PDB:6wouA	0.833	0.307	0.000	3921	0.874	0.312	6wouA.pdb.gz	Structural mechanism of two gain-of-function cardiac and skeletal RyR mutations at an equivalent site by cryo-EM.
6	PDB:7cf9A	0.827	0.298	0.000	3949	0.611	0.217	7cf9A.pdb.gz	Structural basis for diamide modulation of ryanodine receptor.
7	PDB:7m6aA	0.870	0.287	0.000	4306	0.627	0.204	7m6aA.pdb.gz	High-resolution structure of the membrane-embedded skeletal muscle ryanodine receptor.
8	PDB:7t65A	0.860	0.288	0.000	4252	0.626	0.206	7t65A.pdb.gz	Molecular mechanism of the severe MH/CCD mutation Y522S in skeletal ryanodine receptor (RyR1) by cryo-EM.
9	PDB:7tdgA	0.833	0.289	0.000	4134	0.616	0.209	7tdgA.pdb.gz	Ca 2+ -inactivation of the mammalian ryanodine receptor type 1 in a lipidic environment revealed by cryo-EM.
10	PDB:7tzcA	0.876	0.282	0.000	4404	0.628	0.200	7tzcA.pdb.gz	A drug and ATP binding site in type 1 ryanodine receptor.
11	AFDB:A0A0R4IH08	0.339	0.192	7.725E-28	2634	0.099	0.053	A0A0R4IH08.pdb.gz	A0A0R4IH08_DANRE Inositol 1,4,5-trisphosphate receptor OS=Danio rerio OX=7955 GN=si:dkey-163f12.8 PE=3 SV=2
12	AFDB:P18160	0.094	0.056	2.878E-11	2410	0.069	0.040	P18160.pdb.gz	SPLA_DICDI Dual specificity protein kinase splA OS=Dictyostelium discoideum OX=44689 GN=splA PE=1 SV=3
13	AFDB:Q8IVF5	0.055	0.049	2.757E-4	1701	0.115	0.095	Q8IVF5.pdb.gz	TIAM2_HUMAN Rho guanine nucleotide exchange factor TIAM2 OS=Homo sapiens OX=9606 GN=TIAM2 PE=2 SV=4
14	AFDB:Q14993	0.050	0.059	4.052E-2	1142	0.026	0.032	Q14993.pdb.gz	COJA1_HUMAN Collagen alpha-1(XIX) chain OS=Homo sapiens OX=9606 GN=COL19A1 PE=1 SV=3
15	AFDB:Q18508	0.071	0.061	4.835E-2	1784	0.063	0.049	Q18508.pdb.gz	MEL28_CAEEL Protein mel-28 OS=Caenorhabditis elegans OX=6239 GN=mel-28 PE=1 SV=2
16	AFDB:X1WE68	0.076	0.048	5.053E-2	2527	0.054	0.030	X1WE68.pdb.gz
17	AFDB:A0A0G2K069	0.053	0.101	5.769E-2	624	0.029	0.066	A0A0G2K069.pdb.gz	A0A0G2K069_RAT Collagen type XI alpha 2 chain OS=Rattus norvegicus OX=10116 GN=Col11a2 PE=4 SV=2
18	AFDB:E9Q0S6	0.042	0.035	6.587E-2	1888	0.044	0.033	E9Q0S6.pdb.gz	TENS1_MOUSE Tensin-1 OS=Mus musculus OX=10090 GN=Tns1 PE=1 SV=1
19	AFDB:O95490	0.047	0.047	7.520E-2	1459	0.099	0.095	O95490.pdb.gz	AGRL2_HUMAN Adhesion G protein-coupled receptor L2 OS=Homo sapiens OX=9606 GN=ADGRL2 PE=1 SV=2
20	AFDB:Q20712	0.120	0.229	8.972E-2	689	0.025	0.051	Q20712.pdb.gz	Q20712_CAEEL CLASP_N domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=CELE_F53B3.3 PE=1 SV=4

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A060WZC7	0.0	1609	4791	0.538	0.157	A0A060WZC7_ONCMY Skeletal muscle ryanodine receptor OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00004066001 PE=4 SV=1
2	A2AGL3	0.0	1944	4863	0.656	0.189	RYR3_MOUSE Ryanodine receptor 3 OS=Mus musculus OX=10090 GN=Ryr3 PE=1 SV=1
3	A6P4B8	0.0	1973	5076	0.666	0.184	A6P4B8_DANRE Ryanodine receptor 1 OS=Danio rerio OX=7955 GN=si:dkey-250i19.1 PE=1 SV=1
4	B0LPN4	0.0	2868	4953	0.971	0.275	RYR2_RAT Ryanodine receptor 2 OS=Rattus norvegicus OX=10116 GN=Ryr2 PE=1 SV=2
5	B7WN66	0.0	1249	5085	0.449	0.124	B7WN66_CAEEL Ryanodine receptor 44F OS=Caenorhabditis elegans OX=6239 GN=unc-68 PE=1 SV=5
6	E9PZQ0	0.0	1907	5035	0.652	0.181	RYR1_MOUSE Ryanodine receptor 1 OS=Mus musculus OX=10090 GN=Ryr1 PE=1 SV=1
7	E9Q401	0.0	2890	4966	0.976	0.275	RYR2_MOUSE Ryanodine receptor 2 OS=Mus musculus OX=10090 GN=Ryr2 PE=1 SV=1
8	F1LMY4	0.0	1892	5035	0.650	0.181	RYR1_RAT Ryanodine receptor 1 OS=Rattus norvegicus OX=10116 GN=Ryr1 PE=1 SV=1
9	G1U7D3	0.0	1522	4598	0.534	0.163	G1U7D3_RABIT Ryanodine receptor 1 OS=Oryctolagus cuniculus OX=9986 GN=RYR1 PE=4 SV=2
10	I2HAA6	0.0	1249	5187	0.450	0.121	I2HAA6_CAEEL Ryanodine receptor 44F OS=Caenorhabditis elegans OX=6239 GN=unc-68 PE=1 SV=2
11	I2HAA7	0.0	1249	5071	0.449	0.124	I2HAA7_CAEEL Ryanodine receptor 44F OS=Caenorhabditis elegans OX=6239 GN=unc-68 PE=1 SV=2
12	P11716	0.0	1920	5037	0.655	0.182	RYR1_RABIT Ryanodine receptor 1 OS=Oryctolagus cuniculus OX=9986 GN=RYR1 PE=1 SV=1
13	P21817	0.0	1908	5038	0.651	0.181	RYR1_HUMAN Ryanodine receptor 1 OS=Homo sapiens OX=9606 GN=RYR1 PE=1 SV=3
14	P30957	0.0	2922	4969	0.991	0.279	RYR2_RABIT Ryanodine receptor 2 OS=Oryctolagus cuniculus OX=9986 GN=RYR2 PE=1 SV=3
15	Q15413	0.0	1939	4870	0.649	0.187	RYR3_HUMAN Ryanodine receptor 3 OS=Homo sapiens OX=9606 GN=RYR3 PE=1 SV=3
16	Q24498	0.0	1313	5127	0.482	0.132	RYR_DROME Ryanodine receptor OS=Drosophila melanogaster OX=7227 GN=RyR PE=1 SV=3
17	Q92736	0.0	2944	4967	1.000	0.282	RYR2_HUMAN Ryanodine receptor 2 OS=Homo sapiens OX=9606 GN=RYR2 PE=1 SV=3
18	Q94279	0.0	1249	5201	0.449	0.121	Q94279_CAEEL Ryanodine receptor 44F OS=Caenorhabditis elegans OX=6239 GN=unc-68 PE=1 SV=6
19	Q9TS33	0.0	1891	4872	0.640	0.184	RYR3_RABIT Ryanodine receptor 3 OS=Oryctolagus cuniculus OX=9986 GN=RYR3 PE=1 SV=1
20	Q9Z329	1.03e-21	105	2701	0.109	0.057	ITPR2_MOUSE Inositol 1,4,5-trisphosphate receptor type 2 OS=Mus musculus OX=10090 GN=Itpr2 PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF20452 Calmod_bind_C	5.9e+02	12.0	Calmodulin binding protein C-terminal domain
2	PF08709 Ins145_P3_rec	3.7e-63	224.1	Inositol 1,4,5-trisphosphate/ryanodine receptor
3	PF02815 MIR	5e-54	194.5	MIR domain
4	PF01365 RYDR_ITPR	2.1e-67	238.1	RIH domain
5	PF02026 RyR	3.8e-64	224.3	RyR domain
6	PF00622 SPRY	1.3e-43	159.3	SPRY domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000355533

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000370373	0.999	Peptidyl-prolyl cis-trans isomerase FKBP1B
2	9606.ENSP00000368767	0.997	Aspartyl/asparaginyl beta-hydroxylase
3	9606.ENSP00000439281	0.997	Triadin
4	9606.ENSP00000261448	0.995	Calsequestrin-2
5	9606.ENSP00000383003	0.995	Peptidyl-prolyl cis-trans isomerase FKBP1A
6	9606.ENSP00000280979	0.991	A-kinase anchor protein 6
7	9606.ENSP00000349467	0.991	Calmodulin-1
8	9606.ENSP00000266376	0.986	Voltage-dependent L-type calcium channel subunit alpha-1C
9	9606.ENSP00000477999	0.985	Nitric oxide synthase, brain
10	9606.ENSP00000265729	0.982	Sorcin
11	9606.ENSP00000373884	0.979	Ryanodine receptor 3
12	9606.ENSP00000272298	0.977	Calmodulin 2 (phosphorylase kinase, delta)
13	9606.ENSP00000291295	0.967	Calmodulin 3 (phosphorylase kinase, delta)
14	9606.ENSP00000352608	0.955	Ryanodine receptor 1
15	9606.ENSP00000309591	0.953	cAMP-dependent protein kinase catalytic subunit alpha
16	9606.ENSP00000341779	0.952	Serine/threonine-protein phosphatase PP1-gamma catalytic subunit
17	9606.ENSP00000366488	0.952	cAMP-dependent protein kinase catalytic subunit gamma
18	9606.ENSP00000339740	0.941	Calcium/calmodulin-dependent protein kinase type II subunit delta
19	9606.ENSP00000357057	0.935	Calsequestrin-1
20	9606.ENSP00000292169	0.929	Protein S100-A1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.998	protein binding
GO:0015278	0.998	calcium-release channel activity
GO:0005219	0.987	ryanodine-sensitive calcium-release channel activity
GO:0097159	0.690	organic cyclic compound binding
GO:0043167	0.514	ion binding
GO:0005516	0.513	calmodulin binding
GO:0042802	0.508	identical protein binding
GO:0036094	0.424	small molecule binding
GO:0043168	0.362	anion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.962	cellular process
GO:0051179	0.950	localization
GO:0030001	0.928	metal ion transport
GO:0050896	0.921	response to stimulus
GO:0065007	0.894	biological regulation
GO:0050794	0.846	regulation of cellular process
GO:0032501	0.805	multicellular organismal process
GO:0055085	0.743	transmembrane transport
GO:0006936	0.720	muscle contraction
GO:0098660	0.714	inorganic ion transmembrane transport
GO:0055074	0.690	calcium ion homeostasis
GO:0007154	0.686	cell communication
GO:0006874	0.684	intracellular calcium ion homeostasis
GO:0023052	0.662	signaling
GO:0070588	0.654	calcium ion transmembrane transport
GO:0051716	0.643	cellular response to stimulus
GO:0010033	0.630	response to organic substance
GO:0071312	0.588	cellular response to alkaloid
GO:0007224	0.584	smoothened signaling pathway
GO:0008016	0.551	regulation of heart contraction
GO:1901700	0.547	response to oxygen-containing compound
GO:0051282	0.546	regulation of sequestering of calcium ion
GO:0006941	0.546	striated muscle contraction
GO:0014074	0.518	response to purine-containing compound
GO:0031000	0.512	response to caffeine
GO:0006937	0.487	regulation of muscle contraction
GO:0010959	0.485	regulation of metal ion transport
GO:0097553	0.476	calcium ion transmembrane import into cytosol
GO:1904062	0.475	regulation of monoatomic cation transmembrane transport
GO:0051209	0.467	release of sequestered calcium ion into cytosol
GO:0006942	0.466	regulation of striated muscle contraction
GO:0055117	0.436	regulation of cardiac muscle contraction
GO:1903169	0.432	regulation of calcium ion transmembrane transport
GO:0061337	0.406	cardiac conduction
GO:0051279	0.401	regulation of release of sequestered calcium ion into cytosol
GO:0065008	0.394	regulation of biological quality
GO:0071407	0.387	cellular response to organic cyclic compound
GO:1901701	0.349	cellular response to oxygen-containing compound
GO:0010880	0.345	regulation of release of sequestered calcium ion into cytosol by sarcoplasmic reticulum

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043231	0.998	intracellular membrane-bounded organelle
GO:0016020	0.997	membrane
GO:0016528	0.995	sarcoplasm
GO:0016529	0.992	sarcoplasmic reticulum
GO:0032991	0.960	protein-containing complex
GO:0098827	0.918	endoplasmic reticulum subcompartment
GO:0043232	0.915	intracellular non-membrane-bounded organelle
GO:0031090	0.903	organelle membrane
GO:0005789	0.867	endoplasmic reticulum membrane
GO:0098588	0.825	bounding membrane of organelle
GO:0033017	0.801	sarcoplasmic reticulum membrane
GO:0099512	0.635	supramolecular fiber
GO:0030016	0.598	myofibril
GO:0030017	0.594	sarcomere
GO:0034703	0.408	cation channel complex
GO:0031674	0.405	I band

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:29671	0.998	Ca(2+)(in) = Ca(2+)(out)

[back to server]