StarFunc result for job id Q92752

User Input

>input (1358 residues)
MGADGETVVLKNMLIGINLILLGSMIKPSECQLEVTTERVQRQSVEEEGGIANYNTSSKE
QPVVFNHVYNINVPLDNLCSSGLEASAEQEVSAEDETLAEYMGQTSDHESQVTFTHRINF
PKKACPCASSAQVLQELLSRIEMLEREVSVLRDQCNANCCQESAATGQLDYIPHCSGHGN
FSFESCGCICNEGWFGKNCSEPYCPLGCSSRGVCVDGQCICDSEYSGDDCSELRCPTDCS
SRGLCVDGECVCEEPYTGEDCRELRCPGDCSGKGRCANGTCLCEEGYVGEDCGQRQCLNA
CSGRGQCEEGLCVCEEGYQGPDCSAVAPPEDLRVAGISDRSIELEWDGPMAVTEYVISYQ
PTALGGLQLQQRVPGDWSGVTITELEPGLTYNISVYAVISNILSLPITAKVATHLSTPQG
LQFKTITETTVEVQWEPFSFSFDGWEISFIPKNNEGGVIAQVPSDVTSFNQTGLKPGEEY
IVNVVALKEQARSPPTSASVSTVIDGPTQILVRDVSDTVAFVEWIPPRAKVDFILLKYGL
VGGEGGRTTFRLQPPLSQYSVQALRPGSRYEVSVSAVRGTNESDSATTQFTTEIDAPKNL
RVGSRTATSLDLEWDNSEAEVQEYKVVYSTLAGEQYHEVLVPRGIGPTTRATLTDLVPGT
EYGVGISAVMNSQQSVPATMNARTELDSPRDLMVTASSETSISLIWTKASGPIDHYRITF
TPSSGIASEVTVPKDRTSYTLTDLEPGAEYIISVTAERGRQQSLESTVDAFTGFRPISHL
HFSHVTSSSVNITWSDPSPPADRLILNYSPRDEEEEMMEVSLDATKRHAVLMGLQPATEY
IVNLVAVHGTVTSEPIVGSITTGIDPPKDITISNVTKDSVMVSWSPPVASFDYYRVSYRP
TQVGRLDSSVVPNTVTEFTITRLNPATEYEISLNSVRGREESERICTLVHTAMDNPVDLI
ATNITPTEALLQWKAPVGEVENYVIVLTHFAVAGETILVDGVSEEFRLVDLLPSTHYTAT
MYATNGPLTSGTISTNFSTLLDPPANLTASEVTRQSALISWQPPRAEIENYVLTYKSTDG
SRKELIVDAEDTWIRLEGLLENTDYTVLLQAAQDTTWSSITSTAFTTGGRVFPHPQDCAQ
HLMNGDTLSGVYPIFLNGELSQKLQVYCDMTTDGGGWIVFQRRQNGQTDFFRKWADYRVG
FGNVEDEFWLGLDNIHRITSQGRYELRVDMRDGQEAAFASYDRFSVEDSRNLYKLRIGSY
NGTAGDSLSYHQGRPFSTEDRDNDVAVTNCAMSYKGAWWYKNCHRTNLNGKYGESRHSQG
INWYHWKGHEFSIPFVEMKMRPYNHRLMAGRKRQSLQF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0G2K1L0	0.239	0.174	0.000	2019	0.460	0.310	A0A0G2K1L0.pdb.gz	A0A0G2K1L0_RAT Tenascin C OS=Rattus norvegicus OX=10116 GN=Tnc PE=1 SV=2
2	AFDB:A2CF37	0.646	0.649	0.000	1350	0.615	0.619	A2CF37.pdb.gz
3	AFDB:F1QYE2	0.321	0.252	0.000	1811	0.434	0.325	F1QYE2.pdb.gz	F1QYE2_DANRE Tenascin C OS=Danio rerio OX=7955 GN=tenc PE=1 SV=1
4	AFDB:P24821	0.286	0.182	0.000	2201	0.449	0.277	P24821.pdb.gz	TENA_HUMAN Tenascin OS=Homo sapiens OX=9606 GN=TNC PE=1 SV=3
5	AFDB:Q29116	0.246	0.199	0.000	1746	0.458	0.356	Q29116.pdb.gz	TENA_PIG Tenascin OS=Sus scrofa OX=9823 GN=TNC PE=1 SV=1
6	AFDB:Q80Z71	0.195	0.175	0.000	1560	0.353	0.307	Q80Z71.pdb.gz	TENN_MOUSE Tenascin-N OS=Mus musculus OX=10090 GN=Tnn PE=1 SV=2
7	AFDB:Q8BYI9	0.451	0.451	0.000	1358	0.932	0.932	Q8BYI9.pdb.gz	TENR_MOUSE Tenascin-R OS=Mus musculus OX=10090 GN=Tnr PE=1 SV=2
8	AFDB:Q9UQP3	0.207	0.214	0.000	1299	0.342	0.357	Q9UQP3.pdb.gz	TENN_HUMAN Tenascin-N OS=Homo sapiens OX=9606 GN=TNN PE=1 SV=2
9	AFDB:Q62308	0.163	0.255	1.621E-71	860	0.205	0.324	Q62308.pdb.gz	Q62308_MOUSE Tenascin-X (Fragment) OS=Mus musculus OX=10090 GN=Tnxb PE=2 SV=1
10	AFDB:Q28275	0.136	0.087	3.441E-60	2208	0.184	0.113	Q28275.pdb.gz	FINC_CANLF Fibronectin (Fragment) OS=Canis lupus familiaris OX=9615 GN=FN1 PE=2 SV=3
11	PDB:1jc9A	0.151	0.910	3.022E-21	220	0.074	0.455	1jc9A.pdb.gz	The 2.0-A crystal structure of tachylectin 5A provides evidence for the common origin of the innate immunity and the blood coagulation systems.
12	PDB:5a42A	0.098	0.087	9.636E-17	1597	0.080	0.068	5a42A.pdb.gz
13	PDB:3ghgB	0.149	0.493	1.797E-16	401	0.065	0.219	3ghgB.pdb.gz	Crystal structure of human fibrinogen.
14	PDB:1m1jB	0.151	0.498	2.245E-16	402	0.061	0.206	1m1jB.pdb.gz	Crystal Structure of Native Chicken Fibrinogen at 2.7 A Resolution
15	PDB:1ei3C	0.150	0.499	3.750E-14	397	0.060	0.207	1ei3C.pdb.gz
16	PDB:3ghgI	0.152	0.509	7.643E-14	394	0.060	0.208	3ghgI.pdb.gz	Crystal structure of human fibrinogen.
17	PDB:7q5zA	0.083	0.084	1.247E-13	1344	0.067	0.068	7q5zA.pdb.gz
18	PDB:7q1yA	0.099	0.098	1.703E-13	1374	0.054	0.053	7q1yA.pdb.gz
19	PDB:4lnvA	0.095	0.100	1.781E-13	1276	0.064	0.068	4lnvA.pdb.gz
20	PDB:5oj2B	0.099	0.147	2.542E-13	692	0.066	0.130	5oj2B.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2K1L0	0.0	628	2110	0.253	0.163	A0A0G2K1L0_RAT Tenascin C OS=Rattus norvegicus OX=10116 GN=Tnc PE=1 SV=2
2	A0A8I6AG89	0.0	604	2019	0.264	0.178	A0A8I6AG89_RAT Tenascin C OS=Rattus norvegicus OX=10116 GN=Tnc PE=1 SV=1
3	A0A8I6AIS3	0.0	872	1564	0.352	0.306	A0A8I6AIS3_RAT Tenascin C OS=Rattus norvegicus OX=10116 GN=Tnc PE=1 SV=1
4	A0A8I6ARC1	0.0	600	2202	0.263	0.162	A0A8I6ARC1_RAT Tenascin C OS=Rattus norvegicus OX=10116 GN=Tnc PE=1 SV=1
5	A0A8I6GHT4	0.0	634	1928	0.253	0.178	A0A8I6GHT4_RAT Tenascin C OS=Rattus norvegicus OX=10116 GN=Tnc PE=1 SV=1
6	A1L306	0.0	2612	1257	0.926	1.000	A1L306_HUMAN TNR protein OS=Homo sapiens OX=9606 GN=TNR PE=1 SV=1
7	B2LYI9	0.0	601	2019	0.264	0.177	B2LYI9_RAT Tenascin C OS=Rattus norvegicus OX=10116 GN=Tnc PE=2 SV=1
8	E9QHI1	0.0	1078	1720	0.385	0.304	E9QHI1_DANRE Tenascin C OS=Danio rerio OX=7955 GN=tenc PE=1 SV=1
9	F1QYE2	0.0	665	1811	0.267	0.200	F1QYE2_DANRE Tenascin C OS=Danio rerio OX=7955 GN=tenc PE=1 SV=1
10	H1A489	0.0	2197	1356	0.758	0.760	H1A489_TAEGU Tenascin R OS=Taeniopygia guttata OX=59729 GN=TNR PE=3 SV=2
11	P24821	0.0	593	2201	0.264	0.163	TENA_HUMAN Tenascin OS=Homo sapiens OX=9606 GN=TNC PE=1 SV=3
12	Q05546	0.0	2620	1356	0.928	0.929	TENR_RAT Tenascin-R OS=Rattus norvegicus OX=10116 GN=Tnr PE=1 SV=1
13	Q29116	0.0	709	1746	0.289	0.225	TENA_PIG Tenascin OS=Sus scrofa OX=9823 GN=TNC PE=1 SV=1
14	Q7T3T6	0.0	1783	1350	0.612	0.616	Q7T3T6_DANRE Tenascin-R OS=Danio rerio OX=7955 GN=tnr PE=1 SV=1
15	Q80YX1	0.0	630	2110	0.251	0.162	TENA_MOUSE Tenascin OS=Mus musculus OX=10090 GN=Tnc PE=1 SV=1
16	Q80Z71	0.0	660	1560	0.279	0.243	TENN_MOUSE Tenascin-N OS=Mus musculus OX=10090 GN=Tnn PE=1 SV=2
17	Q8BYI9	0.0	2668	1358	0.932	0.932	TENR_MOUSE Tenascin-R OS=Mus musculus OX=10090 GN=Tnr PE=1 SV=2
18	Q92752	0.0	2813	1358	1.000	1.000	TENR_HUMAN Tenascin-R OS=Homo sapiens OX=9606 GN=TNR PE=1 SV=3
19	Q9UQP3	0.0	832	1299	0.353	0.369	TENN_HUMAN Tenascin-N OS=Homo sapiens OX=9606 GN=TNN PE=1 SV=2
20	Q3TAQ2	3.42e-158	513	1332	0.250	0.255	Q3TAQ2_MOUSE Tenascin-X OS=Mus musculus OX=10090 GN=Tnxb PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF17964 Big_10	2.3e+02	13.2	Bacterial Ig domain
2	PF02018 CBM_4_9	0.16	23.7	Carbohydrate binding domain
3	PF16389 DUF4998	0.92	20.6	Domain of unknown function
4	PF07974 EGF_2	4.6e-14	63.8	EGF-like domain
5	PF18720 EGF_Tenascin	1.4e-26	103.3	Tenascin EGF domain
6	PF00147 Fibrinogen_C	7.3e-79	276.2	Fibrinogen beta and gamma chains, C-terminal globular domain
7	PF00041 fn3	1.2e-117	395.8	Fibronectin type III domain
8	PF16893 fn3_2	0.28	22.7	Fibronectin type III domain
9	PF09294 Interfer-bind	6.2e-05	34.6	Interferon-alpha/beta receptor, fibronectin type III
10	PF10179 NDNF	0.014	26.9	Neuron-derived neurotrophic factor, first Fn(III) domain
11	PF19433 NDNF_C	5.4e+02	11.5	Neuron-derived Neurotrophic Factor C-terminal
12	PF03413 PepSY	57	15.7	Peptidase propeptide and YPEB domain
13	PF16656 Pur_ac_phosph_N	1.4e-08	46.5	Purple acid Phosphatase, N-terminal domain
14	PF01108 Tissue_fac	15	16.8	Tissue factor
15	PF07353 Uroplakin_II	3.9	18.4	Uroplakin II

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000356646

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000387356	0.980	Aggrecan core protein
2	9606.ENSP00000252575	0.835	Neurocan core protein
3	9606.ENSP00000261023	0.835	Integrin alpha-V
4	9606.ENSP00000264741	0.835	Integrin alpha-9
5	9606.ENSP00000367316	0.835	Integrin alpha-8
6	9606.ENSP00000283249	0.808	Integrin beta-6
7	9606.ENSP00000379350	0.808	Integrin beta-1
8	9606.ENSP00000452786	0.808	Integrin beta-3
9	9606.ENSP00000361818	0.803	Syndecan-4
10	9606.ENSP00000370542	0.801	Syndecan-1
11	9606.ENSP00000265077	0.764	Versican core protein
12	9606.ENSP00000331210	0.752	Brevican core protein
13	9606.ENSP00000007722	0.670	Integrin alpha-3
14	9606.ENSP00000262407	0.670	Integrin alpha-IIb
15	9606.ENSP00000282588	0.670	Integrin alpha-1
16	9606.ENSP00000293379	0.670	Integrin alpha-5
17	9606.ENSP00000296585	0.670	Integrin alpha-2
18	9606.ENSP00000327290	0.670	Integrin alpha-11
19	9606.ENSP00000358310	0.670	Integrin alpha-10
20	9606.ENSP00000380227	0.670	Integrin alpha-4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0008289	0.975	lipid binding
GO:0044877	0.895	protein-containing complex binding
GO:0050839	0.855	cell adhesion molecule binding
GO:0046625	0.835	sphingolipid binding
GO:0005102	0.754	signaling receptor binding
GO:0005178	0.684	integrin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032501	0.989	multicellular organismal process
GO:0050794	0.988	regulation of cellular process
GO:0009987	0.987	cellular process
GO:0032502	0.986	developmental process
GO:0048856	0.983	anatomical structure development
GO:0007275	0.955	multicellular organism development
GO:0050896	0.891	response to stimulus
GO:0048731	0.890	system development
GO:0030154	0.854	cell differentiation
GO:0048519	0.807	negative regulation of biological process
GO:0048523	0.729	negative regulation of cellular process
GO:0007399	0.718	nervous system development
GO:0009653	0.713	anatomical structure morphogenesis
GO:0007162	0.570	negative regulation of cell adhesion
GO:0051716	0.396	cellular response to stimulus
GO:0071840	0.363	cellular component organization or biogenesis
GO:0048518	0.334	positive regulation of biological process
GO:0016043	0.328	cellular component organization
GO:0007154	0.322	cell communication

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071944	1.000	cell periphery
GO:0030312	0.986	external encapsulating structure
GO:0005576	0.985	extracellular region
GO:0031012	0.984	extracellular matrix
GO:0030054	0.973	cell junction
GO:0005886	0.965	plasma membrane
GO:0045202	0.868	synapse
GO:0032991	0.796	protein-containing complex
GO:0098636	0.755	protein complex involved in cell adhesion
GO:0098978	0.725	glutamatergic synapse
GO:0062023	0.722	collagen-containing extracellular matrix
GO:0043227	0.663	membrane-bounded organelle
GO:0005615	0.587	extracellular space
GO:0009986	0.448	cell surface

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]