StarFunc result for job id Q92753

User Input

>input (470 residues)
MCENQLKTKADATAQIEVIPCKICGDKSSGIHYGVITCEGCKGFFRRSQQNNASYSCPRQ
RNCLIDRTNRNRCQHCRLQKCLALGMSRDAVKFGRMSKKQRDSLYAEVQKHQQRLQEQRQ
QQSGEAEALARVYSSSISNGLSNLNNETSGTYANGHVIDLPKSEGYYNVDSGQPSPDQSG
LDMTGIKQIKQEPIYDLTSVPNLFTYSSFNNGQLAPGITMTEIDRIAQNIIKSHLETCQY
TMEELHQLAWQTHTYEEIKAYQSKSREALWQQCAIQITHAIQYVVEFAKRITGFMELCQN
DQILLLKSGCLEVVLVRMCRAFNPLNNTVLFEGKYGGMQMFKALGSDDLVNEAFDFAKNL
CSLQLTEEEIALFSSAVLISPDRAWLIEPRKVQKLQEKIYFALQHVIQKNHLDDETLAKL
IAKIPTITAVCNLHGEKLQVFKQSHPEIVNTLFPPLYKELFNPDCATGCK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P45446	0.645	0.645	2.969E-61	470	0.979	0.979	P45446.pdb.gz	RORB_RAT Nuclear receptor ROR-beta OS=Rattus norvegicus OX=10116 GN=Rorb PE=1 SV=3
2	AFDB:F1QLY4	0.573	0.576	3.032E-44	468	0.617	0.620	F1QLY4.pdb.gz	RORAA_DANRE Nuclear receptor ROR-alpha A OS=Danio rerio OX=7955 GN=roraa PE=2 SV=2
3	AFDB:P35398	0.598	0.545	2.612E-43	523	0.604	0.543	P35398.pdb.gz	RORA_HUMAN Nuclear receptor ROR-alpha OS=Homo sapiens OX=9606 GN=RORA PE=1 SV=2
4	AFDB:A0A0C4DFP5	0.555	0.479	1.313E-42	548	0.600	0.515	A0A0C4DFP5.pdb.gz	A0A0C4DFP5_HUMAN RAR related orphan receptor A OS=Homo sapiens OX=9606 GN=RORA PE=1 SV=1
5	AFDB:P51449	0.529	0.481	6.516E-38	518	0.498	0.452	P51449.pdb.gz	RORG_HUMAN Nuclear receptor ROR-gamma OS=Homo sapiens OX=9606 GN=RORC PE=1 SV=2
6	AFDB:P51450	0.520	0.474	1.828E-37	516	0.498	0.453	P51450.pdb.gz	RORG_MOUSE Nuclear receptor ROR-gamma OS=Mus musculus OX=10090 GN=Rorc PE=1 SV=1
7	AFDB:P31396	0.524	0.509	4.235E-30	487	0.372	0.359	P31396.pdb.gz	HR3_DROME Probable nuclear hormone receptor HR3 OS=Drosophila melanogaster OX=7227 GN=Hr3 PE=2 SV=1
8	AFDB:P41828	0.441	0.356	1.383E-24	588	0.313	0.250	P41828.pdb.gz	NHR23_CAEEL Nuclear hormone receptor family member nhr-23 OS=Caenorhabditis elegans OX=6239 GN=nhr-23 PE=1 SV=2
9	AFDB:F1RAU6	0.405	0.302	1.384E-21	637	0.311	0.229	F1RAU6.pdb.gz	F1RAU6_DANRE Nuclear receptor subfamily 1 group D member 1 OS=Danio rerio OX=7955 GN=Eip75B PE=3 SV=1
10	AFDB:Q3UV55	0.417	0.321	7.280E-21	615	0.315	0.241	Q3UV55.pdb.gz	NR1D1_MOUSE Nuclear receptor subfamily 1 group D member 1 OS=Mus musculus OX=10090 GN=Nr1d1 PE=1 SV=1
11	PDB:3dzyA	0.377	0.572	5.892E-13	302	0.196	0.305	3dzyA.pdb.gz	Structure of the intact PPAR-gamma-RXR- nuclear receptor complex on DNA.
12	PDB:6fx0A	0.451	0.858	1.445E-12	238	0.151	0.298	6fx0A.pdb.gz	Structure-based design of Trifarotene (CD5789), a potent and selective RAR gamma agonist for the treatment of acne.
13	PDB:1g2nA	0.322	0.589	9.532E-6	246	0.077	0.146	1g2nA.pdb.gz	Crystal structure of the ligand-binding domain of the ultraspiracle protein USP, the ortholog of retinoid X receptors in insects.
14	PDB:7kw7F	0.354	0.603	1.841E-4	259	0.068	0.124	7kw7F.pdb.gz	Structure of Hsp90-Hsp70-Hop-GR reveals the Hsp90 client-loading mechanism.
15	PDB:2ftzA	0.127	0.196	3.303E-1	265	0.074	0.132	2ftzA.pdb.gz
16	PDB:4q25A	0.091	0.167	5.173E-1	211	0.057	0.128	4q25A.pdb.gz
17	PDB:3hajA	0.096	0.132	5.410E-1	286	0.077	0.126	3hajA.pdb.gz	Molecular mechanism of membrane constriction and tubulation mediated by the F-BAR protein Pacsin/Syndapin.
18	PDB:6p25A	0.122	0.090	7.406E-1	731	0.060	0.038	6p25A.pdb.gz	Structure of the eukaryotic protein O-mannosyltransferase Pmt1-Pmt2 complex.
19	PDB:7jvqR	0.094	0.136	7.746E-1	286	0.055	0.091	7jvqR.pdb.gz	Structural insights into the human D1 and D2 dopamine receptor signaling complexes.
20	PDB:6g79S	0.110	0.160	8.101E-1	262	0.070	0.126	6g79S.pdb.gz	Cryo-EM structure of the serotonin 5-HT1Breceptor coupled to heterotrimeric Go.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0C4DFP5	0.0	582	548	0.615	0.527	A0A0C4DFP5_HUMAN RAR related orphan receptor A OS=Homo sapiens OX=9606 GN=RORA PE=1 SV=1
2	A0A0C4DG53	0.0	583	468	0.617	0.620	A0A0C4DG53_HUMAN RAR related orphan receptor A OS=Homo sapiens OX=9606 GN=RORA PE=1 SV=1
3	A0A8I6A803	0.0	589	523	0.621	0.558	A0A8I6A803_RAT RAR-related orphan receptor A OS=Rattus norvegicus OX=10116 GN=Rora PE=3 SV=1
4	F1LZZ3	0.0	585	467	0.619	0.623	F1LZZ3_RAT RAR-related orphan receptor A OS=Rattus norvegicus OX=10116 GN=Rora PE=3 SV=3
5	F1QLY4	0.0	600	468	0.638	0.641	RORAA_DANRE Nuclear receptor ROR-alpha A OS=Danio rerio OX=7955 GN=roraa PE=2 SV=2
6	P35398	0.0	586	523	0.619	0.556	RORA_HUMAN Nuclear receptor ROR-alpha OS=Homo sapiens OX=9606 GN=RORA PE=1 SV=2
7	P45446	0.0	965	470	0.979	0.979	RORB_RAT Nuclear receptor ROR-beta OS=Rattus norvegicus OX=10116 GN=Rorb PE=1 SV=3
8	P51448	0.0	589	523	0.621	0.558	RORA_MOUSE Nuclear receptor ROR-alpha OS=Mus musculus OX=10090 GN=Rora PE=1 SV=1
9	Q8R1B8	0.0	965	470	0.979	0.979	RORB_MOUSE Nuclear receptor ROR-beta OS=Mus musculus OX=10090 GN=Rorb PE=1 SV=3
10	Q92753	0.0	984	470	1.000	1.000	RORB_HUMAN Nuclear receptor ROR-beta OS=Homo sapiens OX=9606 GN=RORB PE=1 SV=3
11	P51449	2.03e-148	435	518	0.517	0.469	RORG_HUMAN Nuclear receptor ROR-gamma OS=Homo sapiens OX=9606 GN=RORC PE=1 SV=2
12	Q6I9R9	2.03e-148	435	518	0.517	0.469	Q6I9R9_HUMAN RAR-related orphan receptor C OS=Homo sapiens OX=9606 GN=RORC PE=2 SV=1
13	F1D8P6	1.18e-146	430	497	0.513	0.485	F1D8P6_HUMAN RAR-related orphan nuclear receptor variant 2 OS=Homo sapiens OX=9606 GN=NR1F3 PE=2 SV=1
14	A0A8I6GEH3	1.26e-143	422	508	0.504	0.467	A0A8I6GEH3_RAT RAR-related orphan receptor C OS=Rattus norvegicus OX=10116 GN=Rorc PE=3 SV=1
15	P51450	1.42e-143	422	516	0.500	0.455	RORG_MOUSE Nuclear receptor ROR-gamma OS=Mus musculus OX=10090 GN=Rorc PE=1 SV=1
16	A0A8I5ZN69	2.66e-143	422	524	0.504	0.452	A0A8I5ZN69_RAT RAR-related orphan receptor C OS=Rattus norvegicus OX=10116 GN=Rorc PE=3 SV=1
17	A0A0G2QC01	3.80e-142	418	487	0.498	0.480	A0A0G2QC01_RAT RAR-related orphan receptor C OS=Rattus norvegicus OX=10116 GN=Rorc PE=3 SV=1
18	P31396	2.30e-99	308	487	0.379	0.366	HR3_DROME Probable nuclear hormone receptor HR3 OS=Drosophila melanogaster OX=7227 GN=Hr3 PE=2 SV=1
19	A0A8I6A746	7.80e-62	206	339	0.277	0.383	A0A8I6A746_RAT RAR-related orphan receptor C OS=Rattus norvegicus OX=10116 GN=Rorc PE=3 SV=1
20	P41828	7.74e-59	205	588	0.345	0.276	NHR23_CAEEL Nuclear hormone receptor family member nhr-23 OS=Caenorhabditis elegans OX=6239 GN=nhr-23 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00104 Hormone_recep	3.1e-16	71.2	Ligand-binding domain of nuclear hormone receptor
2	PF00105 zf-C4	7.7e-30	114.5	Zinc finger, C4 type (two domains)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000060490

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000054088	0.898	RAR-related orphan receptor C
2	9598.ENSPTRP00000021050	0.837	Neuronal PAS domain protein 2
3	9598.ENSPTRP00000051454	0.837	Uncharacterized protein
4	9598.ENSPTRP00000043973	0.815	Uncharacterized protein
5	9598.ENSPTRP00000027642	0.776	Clock homolog
6	9598.ENSPTRP00000020127	0.721	Nuclear receptor coactivator 1
7	9598.ENSPTRP00000036063	0.700	Nuclear factor interleukin-3-regulated protein
8	9598.ENSPTRP00000009157	0.683	Cryptochrome 1 (Photolyase-like)
9	9598.ENSPTRP00000046705	0.669	Uncharacterized protein
10	9598.ENSPTRP00000008155	0.654	Uncharacterized protein
11	9598.ENSPTRP00000043002	0.648	Uncharacterized protein
12	9598.ENSPTRP00000051613	0.637	Basic helix-loop-helix family, member e40
13	9598.ENSPTRP00000059137	0.624	Nuclear receptor corepressor 1
14	9598.ENSPTRP00000056927	0.622	Nuclear receptor corepressor 2
15	9598.ENSPTRP00000040071	0.617	Period circadian clock 2
16	9598.ENSPTRP00000035809	0.610	Maternal embryonic leucine zipper kinase
17	9598.ENSPTRP00000023761	0.602	Nuclear receptor interacting protein 1
18	9598.ENSPTRP00000015535	0.597	Nuclear receptor subfamily 1, group D, member 1
19	9598.ENSPTRP00000001029	0.590	Nuclear transcription factor Y subunit gamma
20	9598.ENSPTRP00000005796	0.590	Synaptotagmin IX

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0000981	0.999	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0005515	0.998	protein binding
GO:0060089	0.997	molecular transducer activity
GO:1990837	0.996	sequence-specific double-stranded DNA binding
GO:0000976	0.991	transcription cis-regulatory region binding
GO:0038023	0.979	signaling receptor activity
GO:0098531	0.973	ligand-activated transcription factor activity
GO:0000977	0.917	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0004879	0.647	nuclear receptor activity
GO:0008134	0.529	transcription factor binding
GO:0000987	0.524	cis-regulatory region sequence-specific DNA binding
GO:0000978	0.448	RNA polymerase II cis-regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.995	regulation of cellular process
GO:0010468	0.968	regulation of gene expression
GO:0051171	0.904	regulation of nitrogen compound metabolic process
GO:0080090	0.893	regulation of primary metabolic process
GO:0031323	0.891	regulation of cellular metabolic process
GO:0019219	0.856	regulation of nucleobase-containing compound metabolic process
GO:0051252	0.847	regulation of RNA metabolic process
GO:0031326	0.811	regulation of cellular biosynthetic process
GO:0010556	0.795	regulation of macromolecule biosynthetic process
GO:2001141	0.792	regulation of RNA biosynthetic process
GO:0006355	0.776	regulation of DNA-templated transcription
GO:0032501	0.730	multicellular organismal process
GO:0032502	0.647	developmental process
GO:0048518	0.607	positive regulation of biological process
GO:0048856	0.604	anatomical structure development
GO:0007275	0.540	multicellular organism development
GO:0009987	0.464	cellular process
GO:0048731	0.428	system development
GO:0048522	0.423	positive regulation of cellular process
GO:0007399	0.400	nervous system development
GO:0050896	0.364	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0031981	0.975	nuclear lumen
GO:0005654	0.945	nucleoplasm
GO:0005737	0.499	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]