StarFunc result for job id Q92754

User Input

>input (450 residues)
MLWKITDNVKYEEDCEDRHDGSSNGNPRVPHLSSAGQHLYSPAPPLSHTGVAEYQPPPYF
PPPYQQLAYSQSADPYSHLGEAYAAAINPLHQPAPTGSQQQAWPGRQSQEGAGLPSHHGR
PAGLLPHLSGLEAGAVSARRDAYRRSDLLLPHAHALDAAGLAENLGLHDMPHQMDEVQNV
DDQHLLLHDQTVIRKGPISMTKNPLNLPCQKELVGAVMNPTEVFCSVPGRLSLLSSTSKY
KVTVAEVQRRLSPPECLNASLLGGVLRRAKSKNGGRSLREKLDKIGLNLPAGRRKAAHVT
LLTSLVEGEAVHLARDFAYVCEAEFPSKPVAEYLTRPHLGGRNEMAARKNMLLAAQQLCK
EFTELLSQDRTPHGTSRLAPVLETNIQNCLSHFSLITHGFGSQAICAAVSALQNYIKEAL
IVIDKSYMNPGDQSPADSNKTLEKMEKHRK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q92754	1.000	1.000	5.246E-62	450	1.000	1.000	Q92754.pdb.gz	AP2C_HUMAN Transcription factor AP-2 gamma OS=Homo sapiens OX=9606 GN=TFAP2C PE=1 SV=1
2	AFDB:Q61312	0.587	0.588	7.756E-55	449	0.896	0.898	Q61312.pdb.gz	AP2C_MOUSE Transcription factor AP-2 gamma OS=Mus musculus OX=10090 GN=Tfap2c PE=1 SV=2
3	AFDB:G2HK15	0.432	0.523	4.625E-13	367	0.147	0.180	G2HK15.pdb.gz	APTF2_CAEEL Transcription factor aptf-2 OS=Caenorhabditis elegans OX=6239 GN=aptf-2 PE=1 SV=1
4	AFDB:Q4WYQ4	0.119	0.109	1.072E-1	493	0.164	0.150	Q4WYQ4.pdb.gz	Q4WYQ4_ASPFU GATA-type sexual development transcription factor NsdD OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=AFUA_3G13870 PE=4 SV=1
5	AFDB:F1Q9J0	0.087	0.082	4.720E-1	480	0.120	0.113	F1Q9J0.pdb.gz
6	AFDB:A0A0B4LFI1	0.082	0.040	5.791E-1	1089	0.124	0.051	A0A0B4LFI1.pdb.gz	A0A0B4LFI1_DROME Stac-like, isoform U OS=Drosophila melanogaster OX=7227 GN=Stacl PE=4 SV=1
7	AFDB:O08815	0.079	0.042	6.094E-1	1206	0.147	0.055	O08815.pdb.gz	SLK_RAT STE20-like serine/threonine-protein kinase OS=Rattus norvegicus OX=10116 GN=Slk PE=1 SV=1
8	AFDB:Q8WWK9	0.094	0.070	7.104E-1	683	0.147	0.097	Q8WWK9.pdb.gz	CKAP2_HUMAN Cytoskeleton-associated protein 2 OS=Homo sapiens OX=9606 GN=CKAP2 PE=1 SV=1
9	AFDB:Q9SW80	0.069	0.048	7.104E-1	739	0.156	0.095	Q9SW80.pdb.gz	BLH2_ARATH BEL1-like homeodomain protein 2 OS=Arabidopsis thaliana OX=3702 GN=BLH2 PE=1 SV=3
10	AFDB:O35177	0.099	0.069	7.477E-1	833	0.147	0.079	O35177.pdb.gz	CASL_MOUSE Enhancer of filamentation 1 OS=Mus musculus OX=10090 GN=Nedd9 PE=1 SV=2
11	PDB:6wfqC	0.105	0.160	1.302	228	0.064	0.127	6wfqC.pdb.gz	Mechanism of NanR gene repression and allosteric induction of bacterial sialic acid metabolism.
12	PDB:7dk8A	0.085	0.070	1.518	558	0.071	0.057	7dk8A.pdb.gz	Crystal structure of the acyl acid amido synthetase GH3-8 from Oryza sativa.
13	PDB:8escS	0.057	0.086	1.681	268	0.082	0.138	8escS.pdb.gz	Structure and flexibility of the yeast NuA4 histone acetyltransferase complex.
14	PDB:3gjxA	0.077	0.041	1.770	1041	0.047	0.020	3gjxA.pdb.gz	Crystal Structure of the Nuclear Export Receptor CRM1 in Complex with Snurportin1 and RanGTP.
15	PDB:6jhoA	0.099	0.171	1.770	200	0.051	0.115	6jhoA.pdb.gz
16	PDB:6ltnA	0.070	0.116	2.063	244	0.049	0.090	6ltnA.pdb.gz
17	PDB:7wttK	0.062	0.035	2.063	1022	0.069	0.030	7wttK.pdb.gz	The nucleoplasmic phase of pre-40S formation prior to nuclear export.
18	PDB:6lk8B	0.072	0.064	2.171	532	0.078	0.066	6lk8B.pdb.gz
19	PDB:6zqaUS	0.080	0.077	2.171	473	0.060	0.057	6zqaUS.pdb.gz	90 S pre-ribosome transformation into the primordial 40 S subunit.
20	PDB:2w6gG	0.120	0.284	2.285	140	0.040	0.129	2w6gG.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5PQZ4	0.0	557	445	0.667	0.674	Q5PQZ4_DANRE Transcription factor AP-2 gamma OS=Danio rerio OX=7955 GN=fb48g05 PE=1 SV=1
2	Q61312	0.0	799	449	0.896	0.898	AP2C_MOUSE Transcription factor AP-2 gamma OS=Mus musculus OX=10090 GN=Tfap2c PE=1 SV=2
3	Q92754	0.0	927	450	1.000	1.000	AP2C_HUMAN Transcription factor AP-2 gamma OS=Homo sapiens OX=9606 GN=TFAP2C PE=1 SV=1
4	A0A6E1XE14	5.12e-177	504	439	0.640	0.656	A0A6E1XE14_HUMAN Transcription factor AP-2-alpha OS=Homo sapiens OX=9606 GN=TFAP2A PE=1 SV=1
5	P05549	5.32e-177	504	437	0.640	0.659	AP2A_HUMAN Transcription factor AP-2-alpha OS=Homo sapiens OX=9606 GN=TFAP2A PE=1 SV=1
6	P34056	1.44e-175	500	437	0.640	0.659	AP2A_MOUSE Transcription factor AP-2-alpha OS=Mus musculus OX=10090 GN=Tfap2a PE=1 SV=2
7	O13111	9.72e-175	498	437	0.638	0.657	O13111_CHICK Transcription factor AP-2-alpha OS=Gallus gallus OX=9031 PE=2 SV=2
8	P58197	7.33e-174	496	437	0.636	0.654	AP2A_RAT Transcription factor AP-2-alpha OS=Rattus norvegicus OX=10116 GN=Tfap2a PE=1 SV=1
9	A0A2R8QRQ5	1.39e-173	496	450	0.616	0.616	A0A2R8QRQ5_DANRE Transcription factor AP-2-alpha OS=Danio rerio OX=7955 GN=ap2 PE=1 SV=1
10	F1QUT4	2.83e-165	474	437	0.591	0.609	F1QUT4_DANRE Transcription factor AP-2-alpha OS=Danio rerio OX=7955 GN=ap2 PE=1 SV=1
11	Q6NYI3	2.28e-164	471	425	0.589	0.624	Q6NYI3_DANRE Transcription factor AP-2-alpha OS=Danio rerio OX=7955 GN=ap2 PE=1 SV=1
12	O93346	1.48e-156	452	449	0.596	0.597	O93346_CHICK Transcription factor AP-2 beta OS=Gallus gallus OX=9031 PE=2 SV=1
13	Q92481	3.62e-156	452	460	0.598	0.585	AP2B_HUMAN Transcription factor AP-2-beta OS=Homo sapiens OX=9606 GN=TFAP2B PE=1 SV=2
14	A0A0G2KAT2	6.94e-156	451	459	0.596	0.584	A0A0G2KAT2_RAT Transcription factor AP-2 beta OS=Rattus norvegicus OX=10116 GN=Tfap2b PE=3 SV=1
15	Q61313	6.94e-156	451	459	0.596	0.584	AP2B_MOUSE Transcription factor AP-2-beta OS=Mus musculus OX=10090 GN=Tfap2b PE=1 SV=2
16	Q4TTV4	1.47e-153	444	439	0.584	0.599	Q4TTV4_DANRE Transcription factor AP-2 beta isoform OS=Danio rerio OX=7955 GN=zgc:110163 PE=2 SV=1
17	D4A505	4.57e-147	428	441	0.573	0.585	D4A505_RAT Transcription factor AP-2 beta OS=Rattus norvegicus OX=10116 GN=Tfap2b PE=3 SV=2
18	Q6VUP9	7.70e-120	358	442	0.451	0.459	AP2E_MOUSE Transcription factor AP-2-epsilon OS=Mus musculus OX=10090 GN=Tfap2e PE=1 SV=2
19	Q6P0E7	1.39e-115	347	423	0.482	0.513	AP2E_DANRE Transcription factor AP-2-epsilon OS=Danio rerio OX=7955 GN=tfap2e PE=2 SV=1
20	Q6VUC0	3.06e-115	347	442	0.424	0.432	AP2E_HUMAN Transcription factor AP-2-epsilon OS=Homo sapiens OX=9606 GN=TFAP2E PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03299 TF_AP-2	2.9e-79	277.1	Transcription factor AP-2

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000201031

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000457230	0.992	WW domain-containing oxidoreductase
2	9606.ENSP00000405330	0.976	Estrogen receptor
3	9606.ENSP00000384367	0.962	BTB/POZ domain-containing protein KCTD1
4	9606.ENSP00000348056	0.951	SUMO-conjugating enzyme UBC9
5	9606.ENSP00000269571	0.938	Receptor tyrosine-protein kinase erbB-2
6	9606.ENSP00000304169	0.927	Pituitary homeobox 2
7	9606.ENSP00000275493	0.923	Epidermal growth factor receptor
8	9606.ENSP00000384849	0.918	Cyclin-dependent kinase inhibitor 1
9	9606.ENSP00000356234	0.909	Lysine-specific demethylase 5B
10	9606.ENSP00000444198	0.906	Cbp/p300-interacting transactivator 2
11	9606.ENSP00000482232	0.900	Glycoprotein hormones, alpha polypeptide
12	9606.ENSP00000479618	0.869	Myc proto-oncogene protein
13	9606.ENSP00000376077	0.804	Small ubiquitin-related modifier 1
14	9606.ENSP00000394390	0.801	BTB/POZ domain-containing protein KCTD15
15	9606.ENSP00000401764	0.797	Cbp/p300-interacting transactivator 1
16	9606.ENSP00000276594	0.796	PR domain zinc finger protein 14
17	9606.ENSP00000250448	0.770	Hepatocyte nuclear factor 3-alpha
18	9606.ENSP00000361721	0.756	Cbp/p300-interacting transactivator 4
19	9606.ENSP00000262238	0.735	Transcriptional repressor protein YY1
20	9606.ENSP00000263253	0.732	Histone acetyltransferase p300

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0000978	1.000	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0001228	0.998	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0001217	0.996	DNA-binding transcription repressor activity
GO:0001227	0.993	DNA-binding transcription repressor activity, RNA polymerase II-specific

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.998	regulation of cellular process
GO:0080090	0.995	regulation of primary metabolic process
GO:0060255	0.995	regulation of macromolecule metabolic process
GO:0010468	0.994	regulation of gene expression
GO:0032502	0.992	developmental process
GO:1903506	0.991	regulation of nucleic acid-templated transcription
GO:0032501	0.983	multicellular organismal process
GO:0009987	0.980	cellular process
GO:0048856	0.980	anatomical structure development
GO:0006355	0.976	regulation of DNA-templated transcription
GO:0007275	0.968	multicellular organism development
GO:0006357	0.965	regulation of transcription by RNA polymerase II
GO:0048731	0.964	system development
GO:0048522	0.948	positive regulation of cellular process
GO:0048513	0.943	animal organ development
GO:0009893	0.935	positive regulation of metabolic process
GO:0031325	0.934	positive regulation of cellular metabolic process
GO:0045944	0.853	positive regulation of transcription by RNA polymerase II
GO:0048519	0.739	negative regulation of biological process
GO:0048523	0.632	negative regulation of cellular process
GO:0050896	0.505	response to stimulus
GO:0010605	0.499	negative regulation of macromolecule metabolic process
GO:0031327	0.417	negative regulation of cellular biosynthetic process
GO:0010558	0.416	negative regulation of macromolecule biosynthetic process
GO:0051172	0.397	negative regulation of nitrogen compound metabolic process
GO:0000003	0.385	reproduction
GO:0051253	0.381	negative regulation of RNA metabolic process
GO:0045892	0.369	negative regulation of DNA-templated transcription
GO:0023052	0.348	signaling
GO:0007154	0.348	cell communication

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0031981	0.931	nuclear lumen
GO:0005654	0.923	nucleoplasm
GO:0005829	0.516	cytosol
GO:0005739	0.326	mitochondrion

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]