StarFunc result for job id Q92759

User Input

>input (462 residues)
MESTPSRGLNRVHLQCRNLQEFLGGLSPGVLDRLYGHPATCLAVFRELPSLAKNWVMRML
FLEQPLPQAAVALWVKKEFSKAQEESTGLLSGLRIWHTQLLPGGLQGLILNPIFRQNLRI
ALLGGGKAWSDDTSQLGPDKHARDVPSLDKYAEERWEVVLHFMVGSPSAAVSQDLAQLLS
QAGLMKSTEPGEPPCITSAGFQFLLLDTPAQLWYFMLQYLQTAQSRGMDLVEILSFLFQL
SFSTLGKDYSVEGMSDSLLNFLQHLREFGLVFQRKRKSRRYYPTRLAINLSSGVSGAGGT
VHQPGFIVVETNYRLYAYTESELQIALIALFSEMLYRFPNMVVAQVTRESVQQAIASGIT
AQQIIHFLRTRAHPVMLKQTPVLPPTITDQIRLWELERDRLRFTEGVLYNQFLSQVDFEL
LLAHARELGVLVFENSAKRLMVVTPAGHSDVKRFWKRQKHSS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A1U9X7S4	0.992	0.992	3.916E-74	462	1.000	1.000	A0A1U9X7S4.pdb.gz	A0A1U9X7S4_HUMAN General transcription factor IIH subunit 4 OS=Homo sapiens OX=9606 PE=3 SV=1
2	PDB:7nvw2	0.674	0.786	5.341E-50	390	0.842	0.997	7nvw2.pdb.gz	Structures of mammalian RNA polymerase II pre-initiation complexes.
3	AFDB:Q9VUR1	0.879	0.818	2.265E-49	499	0.519	0.481	Q9VUR1.pdb.gz	Q9VUR1_DROME General transcription factor IIH subunit 4 OS=Drosophila melanogaster OX=7227 GN=mrn PE=1 SV=1
4	AFDB:P87303	0.849	0.876	9.466E-44	447	0.429	0.443	P87303.pdb.gz	TFB2_SCHPO General transcription and DNA repair factor IIH subunit tfb2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tfb2 PE=1 SV=2
5	PDB:7ena4	0.695	0.701	2.359E-43	457	0.989	1.000	7ena4.pdb.gz	Structures of the human Mediator and Mediator-bound preinitiation complex.
6	AFDB:Q02939	0.832	0.753	7.705E-39	513	0.370	0.333	Q02939.pdb.gz	TFB2_YEAST General transcription and DNA repair factor IIH subunit TFB2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TFB2 PE=1 SV=1
7	PDB:7ml02	0.700	0.701	4.571E-24	461	0.361	0.362	7ml02.pdb.gz	Structural visualization of de novo transcription initiation by Saccharomyces cerevisiae RNA polymerase II.
8	PDB:5oqj2	0.690	0.796	2.532E-19	395	0.232	0.271	5oqj2.pdb.gz	Structures of transcription pre-initiation complex with TFIIH and Mediator.
9	AFDB:Q38B82	0.548	0.512	8.271E-15	500	0.219	0.202	Q38B82.pdb.gz	Q38B82_TRYB2 General transcription factor IIH subunit 4 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.1900 PE=3 SV=1
10	PDB:5ivw2	0.179	0.254	5.004E-11	274	0.563	0.949	5ivw2.pdb.gz	Near-atomic resolution visualization of human transcription promoter opening.
11	AFDB:O53874	0.266	0.193	2.737E-8	756	0.149	0.091	O53874.pdb.gz	O53874_MYCTU Conserved protein OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv0862c PE=1 SV=1
12	AFDB:O00835	0.184	0.110	1.082E-3	800	0.063	0.036	O00835.pdb.gz	ERCC3_DICDI General transcription and DNA repair factor IIH helicase subunit XPB OS=Dictyostelium discoideum OX=44689 GN=repB PE=2 SV=1
13	AFDB:Q38861	0.185	0.115	1.082E-3	767	0.071	0.043	Q38861.pdb.gz	XPB1_ARATH General transcription and DNA repair factor IIH helicase subunit XPB1 OS=Arabidopsis thaliana OX=3702 GN=XPB1 PE=2 SV=3
14	PDB:7lbmW	0.171	0.140	2.697E-3	574	0.056	0.045	7lbmW.pdb.gz	Structure of the human Mediator-bound transcription preinitiation complex.
15	AFDB:Q02870	0.183	0.108	4.164E-3	798	0.048	0.028	Q02870.pdb.gz	ERCC3_DROME General transcription and DNA repair factor IIH helicase subunit XPB OS=Drosophila melanogaster OX=7227 GN=hay PE=1 SV=2
16	PDB:7a6hO	0.155	0.143	4.364E-3	512	0.106	0.096	7a6hO.pdb.gz	Cryo-EM structures of human RNA polymerase III in its unbound and transcribing states.
17	AFDB:A0A2R8Y6W8	0.181	0.106	5.832E-3	807	0.058	0.033	A0A2R8Y6W8.pdb.gz	A0A2R8Y6W8_HUMAN General transcription and DNA repair factor IIH helicase subunit XPB OS=Homo sapiens OX=9606 GN=ERCC3 PE=1 SV=1
18	PDB:7zsa7	0.177	0.135	7.774E-3	616	0.045	0.034	7zsa7.pdb.gz	Structures of transcription preinitiation complex engaged with the +1 nucleosome.
19	PDB:7ml37	0.179	0.153	7.461E-2	548	0.032	0.027	7ml37.pdb.gz	Structural visualization of de novo transcription initiation by Saccharomyces cerevisiae RNA polymerase II.
20	PDB:7z1mO	0.134	0.110	7.461E-2	570	0.143	0.116	7z1mO.pdb.gz	Architecture of the yeast Pol III pre-termination complex and pausing mechanism on poly(dT) termination signals.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A1U9X7S4	0.0	946	462	1.000	1.000	A0A1U9X7S4_HUMAN General transcription factor IIH subunit 4 OS=Homo sapiens OX=9606 PE=3 SV=1
2	Q92759	0.0	946	462	1.000	1.000	TF2H4_HUMAN General transcription factor IIH subunit 4 OS=Homo sapiens OX=9606 GN=GTF2H4 PE=1 SV=1
3	Q9VUR1	1.18e-166	480	499	0.522	0.483	Q9VUR1_DROME General transcription factor IIH subunit 4 OS=Drosophila melanogaster OX=7227 GN=mrn PE=1 SV=1
4	Q95TQ5	2.28e-126	372	350	0.407	0.537	Q95TQ5_DROME General transcription factor IIH subunit 4 OS=Drosophila melanogaster OX=7227 GN=mrn PE=2 SV=1
5	P87303	1.35e-116	351	447	0.422	0.436	TFB2_SCHPO General transcription and DNA repair factor IIH subunit tfb2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tfb2 PE=1 SV=2
6	Q02939	2.80e-91	288	513	0.377	0.339	TFB2_YEAST General transcription and DNA repair factor IIH subunit TFB2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TFB2 PE=1 SV=1
7	Q38B82	6.90e-13	72.8	500	0.180	0.166	Q38B82_TRYB2 General transcription factor IIH subunit 4 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.1900 PE=3 SV=1
8	A0A1U9X8A3	1.3	33.9	457	0.045	0.046	A0A1U9X8A3_HUMAN PHF1 OS=Homo sapiens OX=9606 PE=3 SV=1
9	Q5XI49	1.5	33.5	412	0.045	0.051	Q5XI49_RAT PHD finger protein 1 OS=Rattus norvegicus OX=10116 GN=Phf1 PE=1 SV=1
10	Q6MGC9	1.7	33.5	560	0.045	0.037	Q6MGC9_RAT PHD finger protein 1 OS=Rattus norvegicus OX=10116 GN=Phf1 PE=3 SV=1
11	Q9Z1B8	1.7	33.5	559	0.045	0.038	PHF1_MOUSE PHD finger protein 1 OS=Mus musculus OX=10090 GN=Phf1 PE=1 SV=2
12	A0A0G2K557	1.8	33.5	600	0.045	0.035	A0A0G2K557_RAT PHD finger protein 1 OS=Rattus norvegicus OX=10116 GN=Phf1 PE=3 SV=1
13	O43189	1.9	33.5	567	0.045	0.037	PHF1_HUMAN PHD finger protein 1 OS=Homo sapiens OX=9606 GN=PHF1 PE=1 SV=3
14	B7ZWM3	3.9	32.7	1647	0.050	0.014	B7ZWM3_MOUSE Nhs protein OS=Mus musculus OX=10090 GN=Nhs PE=2 SV=1
15	B9EJX2	3.9	32.7	1626	0.050	0.014	B9EJX2_MOUSE NHS actin remodeling regulator OS=Mus musculus OX=10090 GN=Nhs PE=1 SV=1
16	B1AV60	4.1	32.7	1647	0.050	0.014	B1AV60_MOUSE NHS actin remodeling regulator OS=Mus musculus OX=10090 GN=Nhs PE=1 SV=1
17	B2RXX7	4.2	32.3	1647	0.050	0.014	B2RXX7_MOUSE Nhs protein OS=Mus musculus OX=10090 GN=Nhs PE=2 SV=1
18	P47029	4.3	32.3	1046	0.065	0.029	ALY2_YEAST Arrestin-related trafficking adapter 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ALY2 PE=1 SV=2
19	P85120	4.7	32.3	2058	0.039	0.009	DAPLE_XENLA Protein Daple OS=Xenopus laevis OX=8355 GN=ccdc88c PE=1 SV=1
20	Q03603	6.6	32.0	795	0.052	0.030	DGK3_CAEEL Probable diacylglycerol kinase 3 OS=Caenorhabditis elegans OX=6239 GN=dgk-3 PE=3 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13625 Helicase_C_3	0.026	26.0	Helicase conserved C-terminal domain
2	PF08671 SinI	5.9e+02	11.7	Anti-repressor SinI
3	PF03849 Tfb2	3.2e-126	432.7	Transcription factor Tfb2
4	PF18307 Tfb2_C	3.5e-20	83.5	Transcription factor Tfb2 (p52) C-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9541.XP_005553657.1

Rank	PPI partner	STRING score	Description
1	9541.XP_005552263.1	0.999	Uncharacterized protein
2	9541.XP_005557386.1	0.999	Regulates CDK7, the catalytic subunit of the CDK-activating kinase (CAK) enzymatic complex. CAK activates the cyclin-associated kinases CDK1, CDK2, CDK4 and CDK6 by threonine phosphorylation. CAK complexed to the core-TFIIH basal transcription factor activates RNA polymerase II by serine phosphorylation of the repetitive C-terminal domain (CTD) of its large subunit (POLR2A), allowing its escape from the promoter and elongation of the transcripts. Involved in cell cycle control and in RNA transcription by RNA polymerase II. Its expression and activity are constant throughout the cell cy [...]
3	9541.XP_005572937.1	0.999	ATP-dependent 3'-5' DNA helicase, component of the general transcription and DNA repair factor IIH (TFIIH) core complex, which is involved in general and transcription-coupled nucleotide excision repair (NER) of damaged DNA and, when complexed to CAK, in RNA transcription by RNA polymerase II. In NER, TFIIH acts by opening DNA around the lesion to allow the excision of the damaged oligonucleotide and its replacement by a new DNA fragment. The ATPase activity of XPB/ERCC3, but not its helicase activity, is required for DNA opening. In transcription, TFIIH has an essential role in transc [...]
4	9541.XP_005578515.1	0.999	General transcription factor IIH subunit 1 isoform X1
5	9541.XP_005557156.1	0.997	General transcription factor IIH subunit 2 isoform X1
6	9541.XP_005572629.1	0.997	Uncharacterized protein
7	9541.XP_005595269.1	0.997	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 EST, 6 Proteins, and 96% coverage of the annotated genomic feature by RNAseq alignments, including 12 samples with support for all annotated introns
8	9541.XP_005589633.1	0.988	ERCC excision repair 2, TFIIH core complex helicase subunit
9	9541.XP_005561488.1	0.986	Uncharacterized protein
10	9541.XP_005557128.1	0.983	Cell division protein kinase 7
11	9541.XP_005563048.1	0.980	Recruits TFIIH to the initiation complex and stimulates the RNA polymerase II C-terminal domain kinase and DNA-dependent ATPase activities of TFIIH. Both TFIIH and TFIIE are required for promoter clearance by RNA polymerase
12	9541.XP_005542862.1	0.963	General transcription factor that plays a role in transcription initiation by RNA polymerase II (Pol II). Involved in the pre-initiation complex (PIC) formation and Pol II recruitment at promoter DNA. Together with the TATA box-bound TBP forms the core initiation complex and provides a bridge between TBP and the Pol II- TFIIF complex. Released from the PIC early following the onset of transcription during the initiation and elongation transition and reassociates with TBP during the next transcription cycle. Associates with chromatin to core promoter-specific regions. Binds to two disti [...]
13	9541.XP_005577613.1	0.948	DNA-directed RNA polymerase II subunit RPB7 isoform X1
14	9541.XP_005587768.1	0.946	General transcription factor IIF subunit 1 isoform X1
15	9541.XP_005581284.1	0.938	DNA repair protein complementing XP-A cells isoform X1
16	9541.XP_005548306.1	0.936	Uncharacterized protein
17	9541.XP_005545238.1	0.935	General transcription factor IIE subunit 1-like
18	9541.XP_005548098.1	0.935	Uncharacterized protein
19	9541.XP_005567390.1	0.935	Uncharacterized protein
20	9541.XP_005555264.1	0.931	DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates.

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0016251	0.999	RNA polymerase II general transcription initiation factor activity
GO:0098772	0.376	molecular function regulator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0034654	0.829	nucleobase-containing compound biosynthetic process
GO:0006351	0.822	DNA-templated transcription
GO:0006366	0.750	transcription by RNA polymerase II
GO:0006281	0.625	DNA repair
GO:0050794	0.619	regulation of cellular process
GO:0048522	0.526	positive regulation of cellular process
GO:0045927	0.332	positive regulation of growth
GO:0008284	0.326	positive regulation of cell population proliferation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	0.999	protein-containing complex
GO:0005654	0.999	nucleoplasm
GO:0016607	0.989	nuclear speck
GO:1990234	0.976	transferase complex
GO:0061695	0.967	transferase complex, transferring phosphorus-containing groups
GO:0140513	0.903	nuclear protein-containing complex
GO:0005667	0.900	transcription regulator complex
GO:0016591	0.885	RNA polymerase II, holoenzyme
GO:1902554	0.823	serine/threonine protein kinase complex
GO:0090575	0.780	RNA polymerase II transcription regulator complex
GO:0032806	0.768	carboxy-terminal domain protein kinase complex
GO:0000439	0.647	transcription factor TFIIH core complex
GO:0005675	0.587	transcription factor TFIIH holo complex
GO:0005669	0.438	transcription factor TFIID complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]