StarFunc result for job id Q92764

User Input

>input (455 residues)
MASKCLKAGFSSGSLKSPGGASGGSTRVSAMYSSSSCKLPSLSPVARSFSACSVGLGRSS
YRATSCLPALCLPAGGFATSYSGGGGWFGEGILTGNEKETMQSLNDRLAGYLEKVRQLEQ
ENASLESRIREWCEQQVPYMCPDYQSYFRTIEELQKKTLCSKAENARLVVEIDNAKLAAD
DFRTKYETEVSLRQLVESDINGLRRILDDLTLCKSDLEAQVESLKEELLCLKKNHEEEVN
SLRCQLGDRLNVEVDAAPPVDLNRVLEEMRCQYETLVENNRRDAEDWLDTQSEELNQQVV
SSSEQLQSCQAEIIELRRTVNALEIELQAQHSMRDALESTLAETEARYSSQLAQMQCMIT
NVEAQLAEIRADLERQNQEYQVLLDVRARLECEINTYRGLLESEDSKLPCNPCAPDYSPS
KSCLPCLPAASCGPSAARTNCSPRPICVPCPGGRF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q92764	1.000	1.000	6.643E-61	455	1.000	1.000	Q92764.pdb.gz	KRT35_HUMAN Keratin, type I cuticular Ha5 OS=Homo sapiens OX=9606 GN=KRT35 PE=1 SV=5
2	AFDB:O76013	0.623	0.609	2.539E-40	467	0.681	0.664	O76013.pdb.gz	KRT36_HUMAN Keratin, type I cuticular Ha6 OS=Homo sapiens OX=9606 GN=KRT36 PE=1 SV=1
3	AFDB:B1AQ75	0.475	0.459	5.001E-40	473	0.675	0.649	B1AQ75.pdb.gz	KRT36_MOUSE Keratin, type I cuticular Ha6 OS=Mus musculus OX=10090 GN=Krt36 PE=1 SV=1
4	AFDB:Q14532	0.655	0.665	1.471E-36	448	0.668	0.679	Q14532.pdb.gz	K1H2_HUMAN Keratin, type I cuticular Ha2 OS=Homo sapiens OX=9606 GN=KRT32 PE=1 SV=3
5	AFDB:Q15323	0.603	0.650	5.077E-35	416	0.642	0.702	Q15323.pdb.gz	K1H1_HUMAN Keratin, type I cuticular Ha1 OS=Homo sapiens OX=9606 GN=KRT31 PE=1 SV=3
6	AFDB:O76011	0.578	0.601	3.452E-33	436	0.609	0.635	O76011.pdb.gz	KRT34_HUMAN Keratin, type I cuticular Ha4 OS=Homo sapiens OX=9606 GN=KRT34 PE=1 SV=3
7	AFDB:Q6A162	0.488	0.511	7.906E-33	431	0.565	0.596	Q6A162.pdb.gz	K1C40_HUMAN Keratin, type I cytoskeletal 40 OS=Homo sapiens OX=9606 GN=KRT40 PE=1 SV=2
8	AFDB:Q6IFW3	0.589	0.561	1.480E-29	481	0.527	0.499	Q6IFW3.pdb.gz	K1C39_RAT Keratin, type I cytoskeletal 39 OS=Rattus norvegicus OX=10116 GN=Krt39 PE=3 SV=1
9	AFDB:Q6A163	0.414	0.386	1.085E-27	491	0.549	0.509	Q6A163.pdb.gz	K1C39_HUMAN Keratin, type I cytoskeletal 39 OS=Homo sapiens OX=9606 GN=KRT39 PE=1 SV=2
10	AFDB:Q6PVZ1	0.453	0.442	1.982E-27	467	0.505	0.493	Q6PVZ1.pdb.gz	K1C14_CHICK Keratin, type I cytoskeletal 14 OS=Gallus gallus OX=9031 GN=KRT14 PE=2 SV=1
11	PDB:6wucH	0.095	0.212	8.469	179	0.066	0.168	6wucH.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B1AQ75	0.0	611	473	0.675	0.649	KRT36_MOUSE Keratin, type I cuticular Ha6 OS=Mus musculus OX=10090 GN=Krt36 PE=1 SV=1
2	O76009	0.0	545	404	0.635	0.715	KT33A_HUMAN Keratin, type I cuticular Ha3-I OS=Homo sapiens OX=9606 GN=KRT33A PE=2 SV=2
3	O76011	0.0	536	436	0.607	0.633	KRT34_HUMAN Keratin, type I cuticular Ha4 OS=Homo sapiens OX=9606 GN=KRT34 PE=1 SV=3
4	O76013	0.0	605	467	0.668	0.651	KRT36_HUMAN Keratin, type I cuticular Ha6 OS=Homo sapiens OX=9606 GN=KRT36 PE=1 SV=1
5	Q14525	0.0	535	404	0.613	0.691	KT33B_HUMAN Keratin, type I cuticular Ha3-II OS=Homo sapiens OX=9606 GN=KRT33B PE=1 SV=3
6	Q14532	0.0	573	448	0.662	0.672	K1H2_HUMAN Keratin, type I cuticular Ha2 OS=Homo sapiens OX=9606 GN=KRT32 PE=1 SV=3
7	Q15323	0.0	552	416	0.642	0.702	K1H1_HUMAN Keratin, type I cuticular Ha1 OS=Homo sapiens OX=9606 GN=KRT31 PE=1 SV=3
8	Q92764	0.0	924	455	1.000	1.000	KRT35_HUMAN Keratin, type I cuticular Ha5 OS=Homo sapiens OX=9606 GN=KRT35 PE=1 SV=5
9	Q6A162	2.04e-172	492	431	0.569	0.601	K1C40_HUMAN Keratin, type I cytoskeletal 40 OS=Homo sapiens OX=9606 GN=KRT40 PE=1 SV=2
10	O76015	8.79e-157	453	456	0.536	0.535	KRT38_HUMAN Keratin, type I cuticular Ha8 OS=Homo sapiens OX=9606 GN=KRT38 PE=1 SV=3
11	O76014	8.67e-153	443	449	0.538	0.546	KRT37_HUMAN Keratin, type I cuticular Ha7 OS=Homo sapiens OX=9606 GN=KRT37 PE=1 SV=3
12	Q6IFW3	1.26e-151	441	481	0.534	0.505	K1C39_RAT Keratin, type I cytoskeletal 39 OS=Rattus norvegicus OX=10116 GN=Krt39 PE=3 SV=1
13	Q6A163	6.71e-150	437	491	0.523	0.485	K1C39_HUMAN Keratin, type I cytoskeletal 39 OS=Homo sapiens OX=9606 GN=KRT39 PE=1 SV=2
14	Q6PVZ1	7.13e-137	403	467	0.437	0.426	K1C14_CHICK Keratin, type I cytoskeletal 14 OS=Gallus gallus OX=9031 GN=KRT14 PE=2 SV=1
15	P19001	6.03e-135	396	403	0.431	0.486	K1C19_MOUSE Keratin, type I cytoskeletal 19 OS=Mus musculus OX=10090 GN=Krt19 PE=1 SV=1
16	Q04695	5.24e-134	394	432	0.429	0.451	K1C17_HUMAN Keratin, type I cytoskeletal 17 OS=Homo sapiens OX=9606 GN=KRT17 PE=1 SV=2
17	Q9QWL7	8.19e-134	394	433	0.464	0.487	K1C17_MOUSE Keratin, type I cytoskeletal 17 OS=Mus musculus OX=10090 GN=Krt17 PE=1 SV=3
18	Q6IFU8	1.03e-133	394	433	0.464	0.487	K1C17_RAT Keratin, type I cytoskeletal 17 OS=Rattus norvegicus OX=10116 GN=Krt17 PE=1 SV=1
19	P08727	8.13e-133	390	400	0.404	0.460	K1C19_HUMAN Keratin, type I cytoskeletal 19 OS=Homo sapiens OX=9606 GN=KRT19 PE=1 SV=4
20	P02533	3.02e-131	389	472	0.422	0.407	K1C14_HUMAN Keratin, type I cytoskeletal 14 OS=Homo sapiens OX=9606 GN=KRT14 PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04513 Baculo_PEP_C	9.2e+02	11.3	Baculovirus polyhedron envelope protein, PEP, C terminus
2	PF04977 DivIC	55	15.0	Septum formation initiator
3	PF07889 DUF1664	9.9e+02	11.2	Protein of unknown function (DUF1664)
4	PF00038 Filament	1.7e-104	361.4	Intermediate filament protein
5	PF14389 Lzipper-MIP1	38	16.0	Leucine-zipper of ternary complex factor MIP1
6	PF01920 Prefoldin_2	89	14.5	Prefoldin subunit
7	PF05591 T6SS_VipA	4.3e+02	12.1	Type VI secretion system, VipA, VC_A0107 or Hcp2
8	PF07926 TPR_MLP1_2	42	15.6	TPR/MLP1/MLP2-like protein
9	PF04871 Uso1_p115_C	4.4e+02	12.6	Uso1 / p115 like vesicle tethering protein, C terminal region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000377558

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000301656	0.721	Keratin, type I cytoskeletal 27
2	9606.ENSP00000241305	0.682	Inactive carboxypeptidase-like protein X2
3	9606.ENSP00000439601	0.649	Rho GTPase-activating protein 45
4	9606.ENSP00000258787	0.641	Unconventional myosin-Ig
5	9606.ENSP00000305263	0.578	Keratin, type I cytoskeletal 28
6	9606.ENSP00000243103	0.565	Homeobox protein Hox-C12
7	9606.ENSP00000310573	0.558	Keratin, type I cytoskeletal 25
8	9606.ENSP00000334798	0.531	Keratin, type I cytoskeletal 26
9	9606.ENSP00000257974	0.525	Keratin, type II cuticular Hb2
10	9606.ENSP00000373487	0.521	Keratin, type I cytoskeletal 18
11	9606.ENSP00000209718	0.517	Keratin, type I cytoskeletal 23
12	9606.ENSP00000167586	0.513	Keratin, type I cytoskeletal 14
13	9606.ENSP00000308452	0.513	Keratin, type I cytoskeletal 17
14	9606.ENSP00000246662	0.511	Keratin, type I cytoskeletal 9
15	9606.ENSP00000254043	0.511	Keratin, type I cytoskeletal 15
16	9606.ENSP00000269576	0.509	Keratin, type I cytoskeletal 10
17	9606.ENSP00000317721	0.509	Peroxisomal sarcosine oxidase
18	9606.ENSP00000243056	0.506	Homeobox protein Hox-C13
19	9606.ENSP00000301653	0.506	Keratin, type I cytoskeletal 16
20	9606.ENSP00000251643	0.505	Keratin, type I cytoskeletal 12

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005198	0.601	structural molecule activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032502	0.993	developmental process
GO:0048856	0.950	anatomical structure development
GO:0009987	0.725	cellular process
GO:0008544	0.392	epidermis development
GO:0009653	0.335	anatomical structure morphogenesis
GO:0065007	0.318	biological regulation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005615	0.999	extracellular space
GO:0031982	0.996	vesicle
GO:1903561	0.988	extracellular vesicle
GO:0070062	0.984	extracellular exosome
GO:0043229	0.910	intracellular organelle
GO:0043232	0.895	intracellular non-membrane-bounded organelle
GO:0099512	0.765	supramolecular fiber
GO:0099513	0.753	polymeric cytoskeletal fiber
GO:0005882	0.711	intermediate filament

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]