StarFunc result for job id Q92765

User Input

>input (325 residues)
MVCGSPGGMLLLRAGLLALAALCLLRVPGARAAACEPVRIPLCKSLPWNMTKMPNHLHHS
TQANAILAIEQFEGLLGTHCSPDLLFFLCAMYAPICTIDFQHEPIKPCKSVCERARQGCE
PILIKYRHSWPENLACEELPVYDRGVCISPEAIVTADGADFPMDSSNGNCRGASSERCKC
KPIRATQKTYFRNNYNYVIRAKVKEIKTKCHDVTAVVEVKEILKSSLVNIPRDTVNLYTS
SGCLCPPLNVNEEYIIMGYEDEERSRLLLVEGSIAEKWKDRLGKKVKRWDMKLRHLGLSK
SDSSNSDSTQSQKSGRNSNPRQARN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:D9ZGF6	0.693	0.693	1.527E-60	325	1.000	1.000	D9ZGF6.pdb.gz	D9ZGF6_HUMAN Secreted frizzled-related protein 3 OS=Homo sapiens OX=9606 GN=FRZB PE=3 SV=1
2	AFDB:Q32N13	0.573	0.582	2.503E-47	319	0.705	0.718	Q32N13.pdb.gz	Q32N13_XENLA Secreted frizzled-related protein 3 OS=Xenopus laevis OX=8355 GN=frzb.S PE=2 SV=1
3	AFDB:A0A0B5JQ70	0.418	0.430	4.743E-45	315	0.646	0.667	A0A0B5JQ70.pdb.gz
4	AFDB:Q9Z1N6	0.412	0.383	5.141E-36	351	0.511	0.473	Q9Z1N6.pdb.gz	SFRP4_MOUSE Secreted frizzled-related sequence protein 4 OS=Mus musculus OX=10090 GN=Sfrp4 PE=2 SV=1
5	AFDB:B1WBV2	0.355	0.389	5.409E-16	295	0.209	0.231	B1WBV2.pdb.gz	B1WBV2_RAT Secreted frizzled-related protein 2 OS=Rattus norvegicus OX=10116 GN=Sfrp2 PE=3 SV=1
6	AFDB:Q8AWG4	0.341	0.352	1.144E-15	315	0.218	0.225	Q8AWG4.pdb.gz	Q8AWG4_XENLA Secreted frizzled-related protein 5 OS=Xenopus laevis OX=8355 GN=sfrp5.L PE=2 SV=1
7	AFDB:Q9GUF5	0.356	0.368	2.285E-15	314	0.209	0.217	Q9GUF5.pdb.gz	Q9GUF5_CAEEL Secreted frizzled-related protein 1 OS=Caenorhabditis elegans OX=6239 GN=sfrp-1 PE=3 SV=2
8	AFDB:Q7ZXM6	0.360	0.392	2.564E-15	298	0.188	0.205	Q7ZXM6.pdb.gz	Q7ZXM6_XENLA Secreted frizzled-related protein 2 S homeolog precursor OS=Xenopus laevis OX=8355 GN=sfrp2.S PE=2 SV=1
9	AFDB:Q13467	0.385	0.221	9.650E-15	585	0.222	0.123	Q13467.pdb.gz	FZD5_HUMAN Frizzled-5 OS=Homo sapiens OX=9606 GN=FZD5 PE=1 SV=2
10	AFDB:F1QJG6	0.342	0.358	1.530E-14	310	0.215	0.226	F1QJG6.pdb.gz
11	PDB:1ueaB	0.217	0.358	2.412E-4	181	0.062	0.110	1ueaB.pdb.gz	Mechanism of inhibition of the human matrix metalloproteinase stromelysin-1 by TIMP-1.
12	PDB:1gxdC	0.251	0.393	1.211E-3	192	0.077	0.130	1gxdC.pdb.gz	Structural Insight Into the Complex Formation of Latent Matrix Metalloproteinase 2 with Tissue Inhibitor of Metalloproteinase 2
13	PDB:7nycA	0.252	0.058	1.925E-2	1542	0.052	0.011	7nycA.pdb.gz	Structural basis of soluble membrane attack complex packaging for clearance.
14	PDB:2pi2A	0.215	0.441	8.615E-2	129	0.034	0.085	2pi2A.pdb.gz
15	PDB:8d0bC	0.185	0.387	8.615E-2	121	0.046	0.124	8d0bC.pdb.gz	Structures of the human CST-Pol alpha-primase complex bound to telomere templates.
16	PDB:4v6wAX	0.147	0.309	1.930E-1	143	0.018	0.042	4v6wAX.pdb.gz	Structures of the human and Drosophila 80S ribosome.
17	PDB:2owoA	0.146	0.089	2.045E-1	586	0.018	0.010	2owoA.pdb.gz	Last Stop on the Road to Repair: Structure of E. coli DNA Ligase Bound to Nicked DNA-Adenylate.
18	PDB:4dayB	0.174	0.394	2.295E-1	113	0.046	0.133	4dayB.pdb.gz	Defining the molecular interface that connects the Fanconi anemia protein FANCM to the Bloom syndrome dissolvasome.
19	PDB:3i4oA	0.150	0.540	2.431E-1	68	0.031	0.147	3i4oA.pdb.gz
20	PDB:6i52A	0.189	0.413	2.431E-1	122	0.043	0.115	6i52A.pdb.gz	A structural and dynamic model for the assembly of Replication Protein A on single-stranded DNA.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D9ZGF6	0.0	674	325	1.000	1.000	D9ZGF6_HUMAN Secreted frizzled-related protein 3 OS=Homo sapiens OX=9606 GN=FRZB PE=3 SV=1
2	P97401	0.0	595	323	0.914	0.920	SFRP3_MOUSE Secreted frizzled-related protein 3 OS=Mus musculus OX=10090 GN=Frzb PE=1 SV=1
3	Q92765	0.0	674	325	1.000	1.000	SFRP3_HUMAN Secreted frizzled-related protein 3 OS=Homo sapiens OX=9606 GN=FRZB PE=1 SV=2
4	Q32N13	1.25e-173	486	319	0.714	0.727	Q32N13_XENLA Secreted frizzled-related protein 3 OS=Xenopus laevis OX=8355 GN=frzb.S PE=2 SV=1
5	Q9W6E0	3.29e-158	446	315	0.646	0.667	Q9W6E0_DANRE Secreted frizzled-related protein 3 OS=Danio rerio OX=7955 GN=fzb1 PE=2 SV=1
6	Q9Z1N6	1.64e-107	319	351	0.514	0.476	SFRP4_MOUSE Secreted frizzled-related sequence protein 4 OS=Mus musculus OX=10090 GN=Sfrp4 PE=2 SV=1
7	Q9JLS4	1.66e-107	319	348	0.505	0.471	SFRP4_RAT Secreted frizzled-related protein 4 OS=Rattus norvegicus OX=10116 GN=Sfrp4 PE=2 SV=2
8	Q6FHJ7	1.33e-104	311	346	0.495	0.465	SFRP4_HUMAN Secreted frizzled-related protein 4 OS=Homo sapiens OX=9606 GN=SFRP4 PE=1 SV=2
9	B3DIG4	9.41e-35	135	592	0.182	0.100	B3DIG4_DANRE Frizzled class receptor 5 OS=Danio rerio OX=7955 GN=fzd8c PE=2 SV=1
10	Q8CHL0	4.09e-34	133	585	0.209	0.116	FZD5_RAT Frizzled-5 OS=Rattus norvegicus OX=10116 GN=Fzd5 PE=2 SV=1
11	Q9EQD0	4.34e-34	133	585	0.209	0.116	FZD5_MOUSE Frizzled-5 OS=Mus musculus OX=10090 GN=Fzd5 PE=1 SV=3
12	Q13467	1.32e-33	132	585	0.200	0.111	FZD5_HUMAN Frizzled-5 OS=Homo sapiens OX=9606 GN=FZD5 PE=1 SV=2
13	Q9VVX3	4.12e-32	128	694	0.172	0.081	FRIZ2_DROME Frizzled-2 OS=Drosophila melanogaster OX=7227 GN=fz2 PE=1 SV=1
14	Q9PUK8	4.54e-32	127	549	0.175	0.104	FZD7A_XENLA Frizzled-7-A OS=Xenopus laevis OX=8355 GN=fzd7-a PE=1 SV=2
15	Q8AVJ9	4.83e-32	127	548	0.175	0.104	FZD7B_XENLA Frizzled-7-B OS=Xenopus laevis OX=8355 GN=fzd7-b PE=1 SV=1
16	Q9PWK6	9.68e-32	126	576	0.228	0.128	Q9PWK6_DANRE Frizzled 8b protein OS=Danio rerio OX=7955 GN=ZG06 PE=2 SV=1
17	O93274	1.69e-31	126	581	0.163	0.091	FZD8_XENLA Frizzled-8 OS=Xenopus laevis OX=8355 GN=fzd8 PE=1 SV=1
18	Q6NV44	2.40e-31	125	559	0.175	0.102	Q6NV44_DANRE Frizzled class receptor 7a OS=Danio rerio OX=7955 GN=fzd7a PE=2 SV=2
19	Q90ZT3	2.65e-31	125	559	0.175	0.102	Q90ZT3_DANRE Frizzled 7b OS=Danio rerio OX=7955 GN=zg07 PE=2 SV=1
20	Q61090	3.09e-31	125	572	0.172	0.098	FZD7_MOUSE Frizzled-7 OS=Mus musculus OX=10090 GN=Fzd7 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01392 Fz	2.4e-25	100.8	Fz domain
2	PF01759 NTR	1.4e-18	78.0	UNC-6/NTR/C345C module

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000295113

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000264634	0.934	Protein Wnt-5a
2	9606.ENSP00000293549	0.912	Proto-oncogene Wnt-1
3	9606.ENSP00000265441	0.874	Protein Wnt-2
4	9606.ENSP00000383894	0.871	Matrilin-3
5	9606.ENSP00000364694	0.833	Asporin
6	9606.ENSP00000363081	0.794	Dickkopf-related protein 1
7	9606.ENSP00000426653	0.780	Protein Wnt-8a
8	9606.ENSP00000325526	0.773	Protein Wnt-11
9	9606.ENSP00000286574	0.766	Wnt inhibitory factor 1
10	9606.ENSP00000344456	0.741	Catenin beta-1
11	9606.ENSP00000284523	0.737	Protein Wnt-3a
12	9606.ENSP00000294304	0.723	Low-density lipoprotein receptor-related protein 5
13	9606.ENSP00000358698	0.720	Protein Wnt-2b
14	9606.ENSP00000285018	0.701	Protein Wnt-7a
15	9606.ENSP00000272164	0.698	Protein Wnt-9a
16	9606.ENSP00000340677	0.687	Protein Wnt-8b
17	9606.ENSP00000290167	0.683	Protein Wnt-4
18	9606.ENSP00000379762	0.683	Dickkopf-related protein 3
19	9606.ENSP00000301691	0.681	Sclerostin
20	9606.ENSP00000380379	0.675	Protein Wnt-5b

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0017147	0.541	Wnt-protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032502	0.997	developmental process
GO:0048583	0.995	regulation of response to stimulus
GO:0048523	0.995	negative regulation of cellular process
GO:0048856	0.994	anatomical structure development
GO:0032501	0.993	multicellular organismal process
GO:0030178	0.990	negative regulation of Wnt signaling pathway
GO:0009987	0.989	cellular process
GO:0007275	0.984	multicellular organism development
GO:0060828	0.974	regulation of canonical Wnt signaling pathway
GO:0090090	0.955	negative regulation of canonical Wnt signaling pathway
GO:0048731	0.953	system development
GO:0050793	0.922	regulation of developmental process
GO:0050896	0.835	response to stimulus
GO:0048518	0.826	positive regulation of biological process
GO:0051094	0.823	positive regulation of developmental process
GO:0045595	0.815	regulation of cell differentiation
GO:0048522	0.772	positive regulation of cellular process
GO:0019222	0.743	regulation of metabolic process
GO:0042127	0.725	regulation of cell population proliferation
GO:0051128	0.706	regulation of cellular component organization
GO:0010941	0.703	regulation of cell death
GO:0051716	0.642	cellular response to stimulus
GO:0060255	0.637	regulation of macromolecule metabolic process
GO:0080090	0.624	regulation of primary metabolic process
GO:0040008	0.617	regulation of growth
GO:0001558	0.612	regulation of cell growth
GO:0051171	0.606	regulation of nitrogen compound metabolic process
GO:0045597	0.583	positive regulation of cell differentiation
GO:0007154	0.578	cell communication
GO:0023052	0.577	signaling
GO:0007165	0.566	signal transduction
GO:0031323	0.526	regulation of cellular metabolic process
GO:0045926	0.521	negative regulation of growth
GO:0048513	0.494	animal organ development
GO:0051239	0.462	regulation of multicellular organismal process
GO:0009888	0.445	tissue development
GO:0030154	0.444	cell differentiation
GO:0010468	0.408	regulation of gene expression
GO:0007166	0.402	cell surface receptor signaling pathway
GO:0009889	0.374	regulation of biosynthetic process
GO:0001501	0.372	skeletal system development
GO:0051093	0.370	negative regulation of developmental process
GO:0010556	0.356	regulation of macromolecule biosynthetic process
GO:0007267	0.335	cell-cell signaling
GO:0048584	0.332	positive regulation of response to stimulus
GO:0019219	0.331	regulation of nucleobase-containing compound metabolic process
GO:0009967	0.323	positive regulation of signal transduction
GO:0051252	0.321	regulation of RNA metabolic process
GO:0031326	0.318	regulation of cellular biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005615	0.999	extracellular space
GO:0016020	0.994	membrane
GO:0071944	0.871	cell periphery
GO:0005622	0.511	intracellular anatomical structure
GO:0043226	0.447	organelle
GO:0043227	0.443	membrane-bounded organelle
GO:0005886	0.320	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]