StarFunc result for job id Q92766

User Input

>input (1687 residues)
MTSSSPAGLEGSDLSSINTMMSAVMSVGKVTENGGSPQGIKSPSKPPGPNRIGRRNQETK
EEKSSYNCPLCEKICTTQHQLTMHIRQHNTDTGGADHSCSICGKSLSSASSLDRHMLVHS
GERPYKCTVCGQSFTTNGNMHRHMKIHEKDPNSATATAPPSPLKRRRLSSKRKLSHDAES
EREDPAPAKKMVEDGQSGDLEKKADEVFHCPVCFKEFVCKYGLETHMETHSDNPLRCDIC
CVTFRTHRGLLRHNALVHKQLPRDAMGRPFIQNNPSIPAGFHDLGFTDFSCRKFPRISQA
WCETNLRRCISEQHRFVCDTCDKAFPMLCSLALHKQTHVAADQGQEKPQATPLPGDALDQ
KGFLALLGLQHTKDVRPAPAEEPLPDDNQAIQLQTLKCQLPQDPGCTNLLSLSPFEAASL
GGSLTVLPATKDSIKHLSLQPFQKGFIIQPDSSIVVKPISGESAIELADIQQILKMAASA
PPQISLPPFSKAPAAPLQAIFKHMPPLKPKPLVTPRTVVATSTPPPLINAQQASPGCISP
SLPPPPLKLLKGSVEAASNAHLLQSKSGTQPHAATRLSLQQPRAELPGQPEMKTQLEQDS
IIEALLPLSMEAKIKQEITEGELKAFMTAPGGKKTPAMRKVLYPCRFCNQVFAFSGVLRA
HVRSHLGISPYQCNICDYIAADKAALIRHLRTHSGERPYICKICHYPFTVKANCERHLRK
KHLKATRKDIEKNIEYVSSSAAELVDAFCAPDTVCRLCGEDLKHYRALRIHMRTHCGRGL
GGGHKGRKPFECKECSAAFAAKRNCIHHILKQHLHVPEQDIESYVLAADGLGPAEAPAAE
ASGRGEDSGCAALGDCKPLTAFLEPQNGFLHRGPTQPPPPHVSIKLEPASSFAVDFNEPL
DFSQKGLALVQVKQENISFLSPSSLVPYDCSMEPIDLSIPKNFRKGDKDLATPSEAKKPE
EEAGSSEQPSPCPAPGPSLPVTLGPSGILESPMAPAPAATPEPPAQPLQGPVQLAVPIYS
SALVSSPPLVGSSALLSGTALLRPLRPKPPLLLPKPPVTEELPPLASIAQIISSVSSAPT
LLKTKVADPGPASTGSNTTASDSLGGSVPKAATTATPAATTSPKESSEPPAPASSPEAAS
PTEQGPAGTSKKRGRKRGMRSRPRANSGGVDLDSSGEFASIEKMLATTDTNKFSPFLQTA
EDNTQDEVAGAPADHHGPSDEEQGSPPEDKLLRAKRNSYTNCLQKITCPHCPRVFPWASS
LQRHMLTHTDSQSDAETAAAAGEVLDLTSRDREQPSEGATELRQVAGDAPVEQATAETAS
PVHREEHGRGESHEPEEEHGTEESTGDADGAEEDASSNQSLDLDFATKLMDFKLAEGDGE
AGAGGAASQEQKLACDTCGKSFKFLGTLSRHRKAHGRQEPKDEKGDGASTAEEGPQPAPE
QEEKPPETPAEVVESAPGAGEAPAEKLAEETEGPSDGESAAEKRSSEKSDDDKKPKTDSP
KSVASKADKRKKVCSVCNKRFWSLQDLTRHMRSHTGERPYKCQTCERTFTLKHSLVRHQR
IHQKARHAKHHGKDSDKEERGEEDSENESTHSGNNAVSENEAELAPNASNHMAVTRSRKE
GLASATKDCSHREEKVTAGWPSEPGQGDLNPESPAALGQDLLEPRSKRPAHPILATADGA
SQLVGME

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q92766	1.000	1.000	0.000	1687	1.000	1.000	Q92766.pdb.gz	RREB1_HUMAN Ras-responsive element-binding protein 1 OS=Homo sapiens OX=9606 GN=RREB1 PE=1 SV=3
2	AFDB:Q9W4J1	0.097	0.090	2.002E-24	1894	0.187	0.166	Q9W4J1.pdb.gz	Q9W4J1_DROME Pebbled, isoform A OS=Drosophila melanogaster OX=7227 GN=peb PE=4 SV=2
3	AFDB:O15090	0.067	0.079	2.302E-18	1300	0.114	0.148	O15090.pdb.gz	ZN536_HUMAN Zinc finger protein 536 OS=Homo sapiens OX=9606 GN=ZNF536 PE=1 SV=3
4	AFDB:Q8K083	0.061	0.075	5.581E-17	1302	0.126	0.164	Q8K083.pdb.gz	ZN536_MOUSE Zinc finger protein 536 OS=Mus musculus OX=10090 GN=Znf536 PE=1 SV=1
5	AFDB:A0A1W2PQA1	0.056	0.076	3.392E-16	1069	0.111	0.175	A0A1W2PQA1.pdb.gz	A0A1W2PQA1_HUMAN RE1 silencing transcription factor OS=Homo sapiens OX=9606 GN=REST PE=1 SV=2
6	AFDB:Q5U0U1	0.059	0.070	1.501E-14	1267	0.139	0.185	Q5U0U1.pdb.gz	Q5U0U1_DROME AT17006p OS=Drosophila melanogaster OX=7227 GN=salr PE=2 SV=1
7	AFDB:F1QI36	0.045	0.055	2.211E-12	1313	0.149	0.191	F1QI36.pdb.gz	F1QI36_DANRE Sal-like protein 1 OS=Danio rerio OX=7955 GN=cb896spalt PE=1 SV=1
8	AFDB:Q9IA31	0.051	0.055	4.833E-12	1544	0.140	0.153	Q9IA31.pdb.gz	GLI3_CHICK Transcriptional activator GLI3 (Fragment) OS=Gallus gallus OX=9031 GN=GLI3 PE=1 SV=1
9	AFDB:O75362	0.055	0.080	7.819E-12	1048	0.125	0.201	O75362.pdb.gz	ZN217_HUMAN Zinc finger protein 217 OS=Homo sapiens OX=9606 GN=ZNF217 PE=1 SV=1
10	AFDB:A0A0R4INF0	0.056	0.060	8.166E-11	1570	0.122	0.131	A0A0R4INF0.pdb.gz	A0A0R4INF0_DANRE Zinc finger and BTB domain-containing 4 OS=Danio rerio OX=7955 GN=zbtb4 PE=4 SV=1
11	PDB:3w5kB	0.037	0.269	2.375E-2	110	0.018	0.282	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:4r8pL	0.018	0.080	1.051	254	0.013	0.087	4r8pL.pdb.gz	Crystal structure of the PRC1 ubiquitylation module bound to the nucleosome.
13	PDB:1b8tA	0.020	0.110	2.922	192	0.013	0.115	1b8tA.pdb.gz	Solution structure of the chicken cysteine-rich protein, CRP1, a double-LIM protein implicated in muscle differentiation.
14	PDB:7pmkQ	0.016	0.027	2.922	766	0.008	0.018	7pmkQ.pdb.gz	A conserved mechanism for regulating replisome disassembly in eukaryotes.
15	PDB:7uhyD	0.014	0.058	3.500	288	0.012	0.073	7uhyD.pdb.gz	Structure of the nutrient-sensing hub GATOR2.
16	PDB:4kfzB	0.025	0.149	3.947	148	0.010	0.115	4kfzB.pdb.gz	Conformational flexibility of the oncogenic protein LMO2 primes the formation of the multi-protein transcription complex.
17	PDB:6ff79	0.025	0.083	4.452	432	0.012	0.046	6ff79.pdb.gz	Structure and Conformational Dynamics of the Human Spliceosomal BactComplex.
18	PDB:7nfxy	0.021	0.129	5.021	147	0.008	0.088	7nfxy.pdb.gz	Receptor compaction and GTPase rearrangement drive SRP-mediated cotranslational protein translocation into the ER.
19	PDB:7d4iRF	0.022	0.084	5.332	241	0.007	0.046	7d4iRF.pdb.gz	Cryo-EM structure of 90S small ribosomal precursors complex with Dhr1
20	PDB:7ad8D	0.022	0.071	5.663	280	0.012	0.075	7ad8D.pdb.gz	The TFIIH subunits p44/p62 act as a damage sensor during nucleotide excision repair.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q3UH06	0.0	2591	1700	0.804	0.798	RREB1_MOUSE Ras-responsive element-binding protein 1 OS=Mus musculus OX=10090 GN=Rreb1 PE=1 SV=2
2	Q92766	0.0	3445	1687	1.000	1.000	RREB1_HUMAN Ras-responsive element-binding protein 1 OS=Homo sapiens OX=9606 GN=RREB1 PE=1 SV=3
3	Q7K3V3	2.40e-27	124	1893	0.035	0.031	Q7K3V3_DROME GH10905p OS=Drosophila melanogaster OX=7227 GN=peb PE=2 SV=1
4	Q9W4J1	2.40e-27	124	1894	0.035	0.031	Q9W4J1_DROME Pebbled, isoform A OS=Drosophila melanogaster OX=7227 GN=peb PE=4 SV=2
5	O46205	2.71e-27	124	1920	0.035	0.031	O46205_DROME Zinc-finger nuclear protein hindsight OS=Drosophila melanogaster OX=7227 GN=peb PE=2 SV=1
6	A0A0U1RQ46	8.17e-21	101	609	0.059	0.163	A0A0U1RQ46_MOUSE Zinc finger protein 950 OS=Mus musculus OX=10090 GN=Zfp950 PE=4 SV=1
7	Q9UEG4	2.02e-19	97.8	869	0.049	0.094	ZN629_HUMAN Zinc finger protein 629 OS=Homo sapiens OX=9606 GN=ZNF629 PE=1 SV=2
8	V9GY73	7.36e-19	95.1	627	0.034	0.093	V9GY73_HUMAN CCCTC-binding factor like OS=Homo sapiens OX=9606 GN=CTCFL PE=1 SV=1
9	Q8NI51	1.21e-18	94.7	663	0.034	0.087	CTCFL_HUMAN Transcriptional repressor CTCFL OS=Homo sapiens OX=9606 GN=CTCFL PE=1 SV=2
10	Q16587	1.40e-18	94.4	644	0.044	0.115	ZNF74_HUMAN Zinc finger protein 74 OS=Homo sapiens OX=9606 GN=ZNF74 PE=1 SV=3
11	Q96EQ9	1.51e-18	94.7	843	0.040	0.081	PRDM9_MOUSE Histone-lysine N-methyltransferase PRDM9 OS=Mus musculus OX=10090 GN=Prdm9 PE=1 SV=2
12	Q61164	2.88e-18	93.6	736	0.031	0.072	CTCF_MOUSE Transcriptional repressor CTCF OS=Mus musculus OX=10090 GN=Ctcf PE=1 SV=2
13	Q6JAA4	2.94e-18	93.6	798	0.031	0.065	Q6JAA4_DANRE CCCTC-binding factor OS=Danio rerio OX=7955 GN=im:7152666 PE=1 SV=1
14	A0A2R8YFL0	3.65e-18	93.2	725	0.031	0.073	A0A2R8YFL0_HUMAN CCCTC-binding factor OS=Homo sapiens OX=9606 GN=CTCF PE=1 SV=1
15	Q08705	3.77e-18	93.2	728	0.031	0.071	CTCF_CHICK Transcriptional repressor CTCF OS=Gallus gallus OX=9031 GN=CTCF PE=1 SV=1
16	P49711	3.86e-18	93.2	727	0.031	0.073	CTCF_HUMAN Transcriptional repressor CTCF OS=Homo sapiens OX=9606 GN=CTCF PE=1 SV=1
17	Q9R1D1	4.17e-18	93.2	737	0.031	0.072	CTCF_RAT Transcriptional repressor CTCF OS=Rattus norvegicus OX=10116 GN=Ctcf PE=2 SV=1
18	P08155	7.49e-18	92.4	845	0.040	0.079	KRH1_DROME Krueppel homolog 1 OS=Drosophila melanogaster OX=7227 GN=Kr-h1 PE=2 SV=2
19	Q9NQV7	9.16e-18	92.4	894	0.039	0.074	PRDM9_HUMAN Histone-lysine N-methyltransferase PRDM9 OS=Homo sapiens OX=9606 GN=PRDM9 PE=1 SV=2
20	Q5SXI5	1.04e-17	91.3	585	0.039	0.111	ZN496_MOUSE Zinc finger protein 496 OS=Mus musculus OX=10090 GN=Znf496 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09538 FYDLN_acid	12	17.9	Protein of unknown function (FYDLN_acid)
2	PF00096 zf-C2H2	5.3e-36	132.2	Zinc finger, C2H2 type
3	PF16622 zf-C2H2_11	2.4e+02	12.9	zinc-finger C2H2-type
4	PF13894 zf-C2H2_4	5.3e-33	121.8	C2H2-type zinc finger
5	PF13912 zf-C2H2_6	7.2e-10	49.9	C2H2-type zinc finger
6	PF12171 zf-C2H2_jaz	32	16.2	Zinc-finger double-stranded RNA-binding
7	PF13465 zf-H2C2_2	1.7e-19	80.5	Zinc-finger double domain
8	PF13909 zf-H2C2_5	0.00019	32.4	C2H2-type zinc-finger domain
9	PF12874 zf-met	3.9e-06	38.3	Zinc-finger of C2H2 type

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000369270

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000290921	0.812	C-terminal-binding protein 1
2	9606.ENSP00000295108	0.755	Neurogenic differentiation factor 1
3	9606.ENSP00000331983	0.728	F-actin-uncapping protein LRRC16A
4	9606.ENSP00000383042	0.689	Lysine-specific histone demethylase 1A
5	9606.ENSP00000317903	0.644	R3H domain containing 2
6	9606.ENSP00000261654	0.642	Adhesion G-protein coupled receptor D1
7	9606.ENSP00000331746	0.640	Calcitonin
8	9606.ENSP00000216513	0.630	Homeobox protein SIX4
9	9606.ENSP00000362649	0.614	Histone deacetylase 1
10	9606.ENSP00000430432	0.596	Histone deacetylase 2
11	9606.ENSP00000264784	0.585	Solute carrier family 2, facilitated glucose transporter member 9
12	9606.ENSP00000369895	0.585	Gem-associated protein 8
13	9606.ENSP00000483059	0.569	Nuclear receptor subfamily 2 group C member 2
14	9606.ENSP00000378757	0.566	Monocarboxylate transporter 9
15	9606.ENSP00000394485	0.535	Na(+)/H(+) exchange regulatory cofactor NHE-RF3
16	9606.ENSP00000308716	0.511	Inhibin beta C chain
17	9606.ENSP00000262241	0.509	REST corepressor 1
18	9606.ENSP00000244763	0.508	Translocon-associated protein subunit alpha
19	9606.ENSP00000255681	0.500	O-acetyl-ADP-ribose deacetylase MACROD1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0000981	0.998	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0005515	0.995	protein binding
GO:0001216	0.995	DNA-binding transcription activator activity
GO:0000978	0.995	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0001228	0.946	DNA-binding transcription activator activity, RNA polymerase II-specific

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0045892	0.985	negative regulation of DNA-templated transcription
GO:0006357	0.910	regulation of transcription by RNA polymerase II
GO:0048522	0.909	positive regulation of cellular process
GO:0009987	0.884	cellular process
GO:0000122	0.798	negative regulation of transcription by RNA polymerase II
GO:0051173	0.617	positive regulation of nitrogen compound metabolic process
GO:0010604	0.595	positive regulation of macromolecule metabolic process
GO:0031325	0.591	positive regulation of cellular metabolic process
GO:0045935	0.479	positive regulation of nucleobase-containing compound metabolic process
GO:0051254	0.470	positive regulation of RNA metabolic process
GO:0010557	0.448	positive regulation of macromolecule biosynthetic process
GO:0045893	0.437	positive regulation of DNA-templated transcription
GO:0008152	0.353	metabolic process
GO:0071704	0.322	organic substance metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0043232	0.999	intracellular non-membrane-bounded organelle
GO:0005737	0.771	cytoplasm
GO:0016604	0.724	nuclear body
GO:0005730	0.542	nucleolus
GO:0016607	0.514	nuclear speck
GO:0001650	0.362	fibrillar center
GO:0070062	0.347	extracellular exosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]