StarFunc result for job id Q92769

User Input

>input (488 residues)
MAYSQGGGKKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKA
TAEEMTKYHSDEYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVA
GAVKLNRQQTDMAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHH
GDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNFPMRDGIDDESYGQ
IFKPIISKVMEMYQPSAVVLQCGADSLSGDRLGCFNLTVKGHAKCVEVVKTFNLPLLMLG
GGGYTIRNVARCWTYETAVALDCEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYM
EKIKQRLFENLRMLPHAPGVQMQAIPEDAVHEDSGDEDGEDPDKRISIRASDKRIACDEE
FSDSEDEGEGGRRNVADHKKGAKKARIEEDKKETEDKKTDVKEEDKSKDNSGEKTDTKGT
KSEQLSNP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:B1WBY8	0.805	0.721	1.595E-89	546	0.990	0.885	B1WBY8.pdb.gz	B1WBY8_RAT histone deacetylase (Fragment) OS=Rattus norvegicus OX=10116 GN=Hdac2 PE=2 SV=1
2	AFDB:A0A2R8QIW0	0.867	0.874	9.259E-89	484	0.873	0.880	A0A2R8QIW0.pdb.gz	A0A2R8QIW0_DANRE Histone deacetylase OS=Danio rerio OX=7955 GN=chunp6919 PE=1 SV=1
3	AFDB:O09106	0.874	0.885	2.053E-83	482	0.852	0.863	O09106.pdb.gz	HDAC1_MOUSE Histone deacetylase 1 OS=Mus musculus OX=10090 GN=Hdac1 PE=1 SV=1
4	AFDB:P56518	0.871	0.739	7.747E-82	576	0.787	0.667	P56518.pdb.gz	HDAC1_STRPU Histone deacetylase 1 OS=Strongylocentrotus purpuratus OX=7668 GN=HDAC1 PE=2 SV=1
5	AFDB:Q94517	0.886	0.831	1.207E-79	521	0.764	0.716	Q94517.pdb.gz	HDAC1_DROME Histone deacetylase HDAC1 OS=Drosophila melanogaster OX=7227 GN=HDAC1 PE=1 SV=2
6	AFDB:Q6P2A8	0.721	0.770	4.403E-77	457	0.824	0.880	Q6P2A8.pdb.gz
7	PDB:7zzuB	0.758	0.996	7.366E-75	371	0.760	1.000	7zzuB.pdb.gz	Fragment-Based Discovery of a Novel, Brain Penetrant, Orally Active HDAC2 Inhibitor.
8	AFDB:O17695	0.859	0.908	9.442E-71	461	0.596	0.631	O17695.pdb.gz	HDA1_CAEEL Histone deacetylase 1 OS=Caenorhabditis elegans OX=6239 GN=hda-1 PE=1 SV=1
9	AFDB:O22446	0.800	0.780	1.134E-67	501	0.557	0.543	O22446.pdb.gz	HDA19_ARATH Histone deacetylase 19 OS=Arabidopsis thaliana OX=3702 GN=HDA19 PE=1 SV=2
10	AFDB:G5ECH0	0.829	0.869	5.244E-67	465	0.564	0.591	G5ECH0.pdb.gz	G5ECH0_CAEEL Histone deacetylase OS=Caenorhabditis elegans OX=6239 GN=hda-3 PE=1 SV=1
11	AFDB:Q5ADP0	0.844	0.715	1.541E-66	577	0.566	0.478	Q5ADP0.pdb.gz	Q5ADP0_CANAL histone deacetylase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=RPD31 PE=1 SV=1
12	PDB:3sfhA	0.669	0.948	2.634E-41	342	0.299	0.427	3sfhA.pdb.gz	Human HDAC isoform selectivity achieved via exploitation of the acetate release channel with structurally unique small molecule inhibitors.
13	PDB:4qa0A	0.718	0.939	5.507E-41	371	0.305	0.402	4qa0A.pdb.gz	Compromised Structure and Function of HDAC8 Mutants Identified in Cornelia de Lange Syndrome Spectrum Disorders.
14	PDB:5g0yB	0.608	0.778	7.975E-25	377	0.182	0.236	5g0yB.pdb.gz	Crystal Structure of a Histone Deacetylase Homologue from Pseudomonas aeruginosa.
15	PDB:5eduB	0.616	0.422	7.045E-23	723	0.166	0.112	5eduB.pdb.gz	Histone deacetylase 6 structure and molecular basis of catalysis and inhibition.
16	PDB:7sggA	0.600	0.460	1.346E-21	644	0.154	0.116	7sggA.pdb.gz	Aza-SAHA Derivatives Are Selective Histone Deacetylase 10 Chemical Probes That Inhibit Polyamine Deacetylation and Phenocopy HDAC10 Knockout.
17	PDB:6z6fB	0.587	0.439	1.633E-20	661	0.189	0.139	6z6fB.pdb.gz	Structural basis for the regulation of nucleosome recognition and HDAC activity by histone deacetylase assemblies.
18	PDB:6uijA	0.589	0.468	3.413E-20	620	0.143	0.113	6uijA.pdb.gz	Binding ofN8-Acetylspermidine Analogues to Histone Deacetylase 10 Reveals Molecular Strategies for Blocking Polyamine Deacetylation.
19	PDB:5ikkA	0.546	0.454	2.947E-19	594	0.162	0.133	5ikkA.pdb.gz	SHREC Silences Heterochromatin via Distinct Remodeling and Deacetylation Modules.
20	PDB:6dktE	0.311	0.499	1.341E-4	268	0.084	0.153	6dktE.pdb.gz	Structure of Arginase from Bacillus subtilis at 2.08 Angstroms resolution

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A1D8PSA6	559	480	0.533	0.542	A0A1D8PSA6_CANAL Histone deacetylase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=RPD3 PE=3 SV=1
2	A0A2R8QIW0	838	484	0.832	0.839	A0A2R8QIW0_DANRE Histone deacetylase OS=Danio rerio OX=7955 GN=chunp6919 PE=1 SV=1
3	A0A8I6AP99	962	471	0.936	0.970	A0A8I6AP99_RAT Histone deacetylase 2 OS=Rattus norvegicus OX=10116 GN=Hdac2 PE=1 SV=1
4	B1WBY8	1014	546	0.990	0.885	B1WBY8_RAT histone deacetylase (Fragment) OS=Rattus norvegicus OX=10116 GN=Hdac2 PE=2 SV=1
5	F7ENH8	1013	488	0.990	0.990	F7ENH8_RAT Histone deacetylase 2 OS=Rattus norvegicus OX=10116 GN=Hdac2 PE=1 SV=1
6	G5EB64	613	687	0.588	0.418	G5EB64_EMENI histone deacetylase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_04493 PE=3 SV=1
7	G5ECH0	605	465	0.574	0.602	G5ECH0_CAEEL Histone deacetylase OS=Caenorhabditis elegans OX=6239 GN=hda-3 PE=1 SV=1
8	O09106	813	482	0.820	0.830	HDAC1_MOUSE Histone deacetylase 1 OS=Mus musculus OX=10090 GN=Hdac1 PE=1 SV=1
9	O15379	550	428	0.496	0.565	HDAC3_HUMAN Histone deacetylase 3 OS=Homo sapiens OX=9606 GN=HDAC3 PE=1 SV=2
10	O17695	636	461	0.598	0.633	HDA1_CAEEL Histone deacetylase 1 OS=Caenorhabditis elegans OX=6239 GN=hda-1 PE=1 SV=1
11	O22446	561	501	0.537	0.523	HDA19_ARATH Histone deacetylase 19 OS=Arabidopsis thaliana OX=3702 GN=HDA19 PE=1 SV=2
12	O59702	550	405	0.498	0.600	CLR6_SCHPO Histone deacetylase clr6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=clr6 PE=1 SV=1
13	O88895	552	428	0.498	0.568	HDAC3_MOUSE Histone deacetylase 3 OS=Mus musculus OX=10090 GN=Hdac3 PE=1 SV=2
14	P32561	568	433	0.531	0.598	RPD3_YEAST Histone deacetylase RPD3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RPD3 PE=1 SV=1
15	P56517	837	480	0.826	0.840	HDAC1_CHICK Histone deacetylase 1 OS=Gallus gallus OX=9031 GN=HDAC1 PE=2 SV=1
16	P56518	792	576	0.787	0.667	HDAC1_STRPU Histone deacetylase 1 OS=Strongylocentrotus purpuratus OX=7668 GN=HDAC1 PE=2 SV=1
17	P56519	998	488	0.982	0.982	HDAC2_CHICK Histone deacetylase 2 OS=Gallus gallus OX=9031 GN=HDAC2 PE=2 SV=1
18	P56520	558	428	0.514	0.586	HDAC3_CHICK Histone deacetylase 3 OS=Gallus gallus OX=9031 GN=HDAC3 PE=2 SV=1
19	P70288	1014	488	0.994	0.994	HDAC2_MOUSE Histone deacetylase 2 OS=Mus musculus OX=10090 GN=Hdac2 PE=1 SV=1
20	Q13547	807	482	0.818	0.828	HDAC1_HUMAN Histone deacetylase 1 OS=Homo sapiens OX=9606 GN=HDAC1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00850 Hist_deacetyl	6e-84	293.6	Histone deacetylase domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9541.XP_005551686.1

Rank	PPI partner	STRING score	Description
1	9541.XP_005560180.1	0.999	Transcriptional corepressor Sin3a
2	9541.XP_005544162.1	0.997	Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes
3	9541.XP_005569975.1	0.997	chromodomain-helicase-DNA-binding protein 4 isoform X1
4	9541.XP_005556371.1	0.996	Sin3A associated protein 30
5	9541.XP_005562310.1	0.995	Uncharacterized protein
6	9541.XP_005593110.1	0.993	Core histone-binding subunit that may target chromatin remodeling factors, histone acetyltransferases and histone deacetylases to their histone substrates in a manner that is regulated by nucleosomal DNA. Component of several complexes which regulate chromatin metabolism. These include the type B histone acetyltransferase (HAT) complex, which is required for chromatin assembly following DNA replication
7	9541.XP_005554321.1	0.990	Belongs to the D-isomer specific 2-hydroxyacid dehydrogenase family
8	9541.XP_005583035.1	0.990	Uncharacterized protein
9	9541.XP_005544551.1	0.989	Lysine-specific histone demethylase 1A isoform X4
10	9541.XP_005562259.1	0.989	Transcriptional repressor protein YY1
11	9541.XP_005577645.1	0.989	Metastasis-associated 1-like 1
12	9541.XP_005562459.1	0.988	Metastasis-associated protein MTA1 isoform X1
13	9541.XP_005572651.1	0.987	Nuclear receptor corepressor 2 isoform X1
14	9541.XP_005585892.1	0.985	PRb
15	9541.XP_005554682.1	0.980	Recombination signal binding protein for immunoglobulin kappa J region
16	9541.XP_005582843.1	0.980	Acts as a tumor suppressor in many tumor types
17	9541.XP_005586721.1	0.979	Methyl-CpG-binding protein MBD2
18	9541.XP_005577305.1	0.977	Nuclear factor NF-kappa-B p65 subunit
19	9541.XP_005582858.1	0.977	chromodomain-helicase-DNA-binding protein 3 isoform X1
20	9541.XP_005587473.1	0.975	Methyl-CpG-binding protein MBD3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004407	1.000	histone deacetylase activity
GO:0003682	0.999	chromatin binding
GO:0140297	0.999	DNA-binding transcription factor binding
GO:0140110	0.957	transcription regulator activity
GO:0003712	0.905	transcription coregulator activity
GO:0003714	0.892	transcription corepressor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.987	cellular process
GO:0050789	0.938	regulation of biological process
GO:0009892	0.885	negative regulation of metabolic process
GO:0060255	0.883	regulation of macromolecule metabolic process
GO:0050794	0.825	regulation of cellular process
GO:0010468	0.767	regulation of gene expression
GO:0051171	0.764	regulation of nitrogen compound metabolic process
GO:0010605	0.763	negative regulation of macromolecule metabolic process
GO:0031323	0.758	regulation of cellular metabolic process
GO:0080090	0.756	regulation of primary metabolic process
GO:0009889	0.752	regulation of biosynthetic process
GO:0031326	0.739	regulation of cellular biosynthetic process
GO:0010556	0.735	regulation of macromolecule biosynthetic process
GO:0051252	0.735	regulation of RNA metabolic process
GO:0006355	0.724	regulation of DNA-templated transcription
GO:1903507	0.676	negative regulation of nucleic acid-templated transcription
GO:0045892	0.672	negative regulation of DNA-templated transcription
GO:0032501	0.508	multicellular organismal process
GO:0006325	0.431	chromatin organization
GO:0032502	0.428	developmental process
GO:0048856	0.423	anatomical structure development
GO:0007275	0.408	multicellular organism development
GO:0006357	0.377	regulation of transcription by RNA polymerase II
GO:0048731	0.338	system development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005654	0.997	nucleoplasm
GO:0043232	0.993	intracellular non-membrane-bounded organelle
GO:0032991	0.992	protein-containing complex
GO:0000785	0.983	chromatin
GO:1902494	0.981	catalytic complex
GO:0000118	0.915	histone deacetylase complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:58196	1.000	H2O + N(6)-acetyl-L-lysyl-[histone] = acetate + L-lysyl-[histone]
EC:3.5.1.98	1.000	histone deacetylase.

[back to server]