StarFunc result for job id Q92771

User Input

>input (950 residues)
MRSGGGCSGSLSLRGPASFKFSGVCPDSRGLAFSVAILPAKKEDFMAELYRVLEAGKIGI
FESPTGTGKSLSLICGALSWLRDFEQKKREEEARLLETGTGPLHDEKDESLCLSSSCEGA
AGTPRPAGEPAWVTQFVQKKEERDLVNRLKAEQARRKQREERLQQLQHRVQLKYAAKRLR
QEEEERENLLRLSREMLETGPEAERPEQLESGEEELVLAEYESDEEKKVASGVDEDEDDL
EEEHITKIYHCSRTHSQLAQFVHEVKKSPFGKDVRLVSLGSRQNLCVNEDVRSLGSVQLI
NNRCVDMQRSRHEKKKGAEEEKPKRRRQEKQAACPFYNHEQMGLLRDEALAEVKDMEQLL
ALGKEARACPYYGSRLAIPAAQLVVLPYQMLLHAATRQAAGIRLQDQVVIIDEAHNLIDT
TTSMHSVEVSGSQLCQAHSQLLQYMERYGKRLKAKNLMYLKQILYLLEKFVAVLGGNIKQ
NPNTQSLSQTGMELKTINDFLFQSQIDNINLFKVQRYCEKSMISRKLFGFTERYGAVFSS
REQPKLAGFQQFLQSLQPRTTEALAAPADESQASVPQPASPLMHIEGFLAALTTANQDGR
VILSRQGSLSQSTLKFLLLNPAVHFAQVVKECRAVVIAGGTMQPVSNFRQQLLACAGVEA
ERVVEFSCGHVIPPDNILPLVICSGVSNQPLEFTFQKRDLPQMMDEVGRILCNLCGVVSG
GVVCFFPSYEYLRQVHAHWEKGGLLGRLAARKKIFQEPKSAHQVEQVLLAYSRCLQACGQ
ERGPVTGALLLSVVGGKMSEGINFSDNLGRCVVMVGMPFPNIRSAELQEKMAYLDQTLPR
APGQAHPGKALVENLCMKAVNQSIGRAIRHQKDFASIVLLDQRYARPPVLAKLPAWIRAR
VEVKATFGPAIAAVQKVSPTFFFLRASQPRDHISHCLLSAQFHREKSASS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:F1R345	0.853	0.909	0.000	890	0.554	0.591	F1R345.pdb.gz	DDX11_DANRE ATP-dependent DNA helicase DDX11 OS=Danio rerio OX=7955 GN=ddx11 PE=2 SV=1
2	AFDB:Q96FC9	0.817	0.801	0.000	970	0.818	0.801	Q96FC9.pdb.gz	DDX11_HUMAN ATP-dependent DNA helicase DDX11 OS=Homo sapiens OX=9606 GN=DDX11 PE=1 SV=1
3	AFDB:Q9CA92	0.695	0.746	1.097E-71	882	0.326	0.351	Q9CA92.pdb.gz	Q9CA92_ARATH DNA helicase OS=Arabidopsis thaliana OX=3702 GN=At1g79890 PE=1 SV=1
4	AFDB:Q21489	0.733	0.835	2.256E-71	830	0.304	0.348	Q21489.pdb.gz	CHL1_CAEEL ATP-dependent DNA helicase chl-1 OS=Caenorhabditis elegans OX=6239 GN=chl-1 PE=3 SV=2
5	AFDB:O14147	0.716	0.802	9.337E-69	844	0.317	0.357	O14147.pdb.gz	CHL1_SCHPO ATP-dependent DNA helicase chl1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=chl1 PE=3 SV=1
6	AFDB:P22516	0.676	0.741	1.283E-64	861	0.294	0.324	P22516.pdb.gz	CHL1_YEAST ATP-dependent DNA helicase CHL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CHL1 PE=1 SV=1
7	AFDB:Q38BP4	0.629	0.568	8.587E-54	1056	0.258	0.232	Q38BP4.pdb.gz	Q38BP4_TRYB2 DNA repair helicase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.3870 PE=4 SV=1
8	AFDB:Q9BX63	0.585	0.451	1.145E-51	1249	0.220	0.167	Q9BX63.pdb.gz	FANCJ_HUMAN Fanconi anemia group J protein OS=Homo sapiens OX=9606 GN=BRIP1 PE=1 SV=2
9	AFDB:Q5SXJ3	0.605	0.496	4.599E-51	1174	0.229	0.186	Q5SXJ3.pdb.gz	FANCJ_MOUSE Fanconi anemia group J protein homolog OS=Mus musculus OX=10090 GN=Brip1 PE=2 SV=1
10	AFDB:Q3YK19	0.621	0.478	8.532E-51	1252	0.242	0.184	Q3YK19.pdb.gz	FANCJ_CHICK Fanconi anemia group J protein homolog OS=Gallus gallus OX=9031 GN=BRIP1 PE=2 SV=1
11	PDB:7ad8B	0.612	0.847	6.470E-35	675	0.187	0.264	7ad8B.pdb.gz	The TFIIH subunits p44/p62 act as a damage sensor during nucleotide excision repair.
12	PDB:7k010	0.515	0.637	2.180E-32	754	0.161	0.203	7k010.pdb.gz	Cryo-EM structure of TFIIH/Rad4-Rad23-Rad33 in damaged DNA opening in nucleotide excision repair.
13	PDB:7lbmX	0.527	0.649	3.291E-32	760	0.178	0.222	7lbmX.pdb.gz	Structure of the human Mediator-bound transcription preinitiation complex.
14	PDB:5fmfY	0.438	0.683	6.119E-25	578	0.115	0.189	5fmfY.pdb.gz	Structure of an RNA Polymerase II Pre-Initiation Complex
15	PDB:5svaY	0.425	0.680	8.719E-22	562	0.122	0.206	5svaY.pdb.gz	Structure of a Complete Mediator-RNA Polymerase II Pre-Initiation Complex.
16	PDB:6fwrA	0.474	0.625	9.811E-21	699	0.106	0.144	6fwrA.pdb.gz	DNA translocation mechanism of an XPD family helicase.
17	PDB:3crvA	0.386	0.612	1.481E-20	551	0.107	0.185	3crvA.pdb.gz	XPD helicase structures and activities: insights into the cancer and aging phenotypes from XPD mutations.
18	PDB:3crw1	0.336	0.604	1.962E-15	485	0.096	0.188	3crw1.pdb.gz	XPD helicase structures and activities: insights into the cancer and aging phenotypes from XPD mutations.
19	PDB:2vdaA	0.194	0.217	9.023E-6	828	0.089	0.103	2vdaA.pdb.gz	Structural Basis for Signal-Sequence Recognition by the Translocase Motor Seca as Determined by NMR
20	PDB:6goxA	0.202	0.237	2.280E-5	777	0.079	0.097	6goxA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A8MPP1	0.0	1746	907	0.908	0.951	D11L8_HUMAN Putative ATP-dependent RNA helicase DDX11-like protein 8 OS=Homo sapiens OX=9606 GN=DDX11L8 PE=1 SV=1
2	C9K0E8	0.0	540	302	0.287	0.904	C9K0E8_HUMAN DEAD/H-box helicase 11 (Fragment) OS=Homo sapiens OX=9606 GN=DDX11 PE=1 SV=2
3	F1R345	0.0	1068	890	0.563	0.601	DDX11_DANRE ATP-dependent DNA helicase DDX11 OS=Danio rerio OX=7955 GN=ddx11 PE=2 SV=1
4	Q96FC9	0.0	1583	970	0.820	0.803	DDX11_HUMAN ATP-dependent DNA helicase DDX11 OS=Homo sapiens OX=9606 GN=DDX11 PE=1 SV=1
5	O14147	1.99e-166	509	844	0.327	0.368	CHL1_SCHPO ATP-dependent DNA helicase chl1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=chl1 PE=3 SV=1
6	Q9CA92	8.67e-159	491	882	0.345	0.372	Q9CA92_ARATH DNA helicase OS=Arabidopsis thaliana OX=3702 GN=At1g79890 PE=1 SV=1
7	F5GXJ8	2.21e-148	440	224	0.232	0.982	F5GXJ8_HUMAN DEAD/H-box helicase 11 (Fragment) OS=Homo sapiens OX=9606 GN=DDX11 PE=1 SV=1
8	Q21489	1.05e-142	447	830	0.316	0.361	CHL1_CAEEL ATP-dependent DNA helicase chl-1 OS=Caenorhabditis elegans OX=6239 GN=chl-1 PE=3 SV=2
9	P22516	3.12e-132	421	861	0.315	0.347	CHL1_YEAST ATP-dependent DNA helicase CHL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CHL1 PE=1 SV=1
10	F5GXL6	1.14e-84	272	191	0.138	0.686	F5GXL6_HUMAN DEAD/H-box helicase 11 (Fragment) OS=Homo sapiens OX=9606 GN=DDX11 PE=4 SV=8
11	A0A0G2K475	1.50e-78	280	1166	0.254	0.207	A0A0G2K475_RAT BRCA1 interacting protein C-terminal helicase 1 OS=Rattus norvegicus OX=10116 GN=Brip1 PE=1 SV=1
12	Q3YK19	5.37e-71	259	1252	0.260	0.197	FANCJ_CHICK Fanconi anemia group J protein homolog OS=Gallus gallus OX=9031 GN=BRIP1 PE=2 SV=1
13	Q5SXJ3	1.15e-70	257	1174	0.204	0.165	FANCJ_MOUSE Fanconi anemia group J protein homolog OS=Mus musculus OX=10090 GN=Brip1 PE=2 SV=1
14	Q9BX63	2.09e-69	254	1249	0.201	0.153	FANCJ_HUMAN Fanconi anemia group J protein OS=Homo sapiens OX=9606 GN=BRIP1 PE=1 SV=2
15	Q38BP4	1.45e-63	235	1056	0.244	0.220	Q38BP4_TRYB2 DNA repair helicase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.3870 PE=4 SV=1
16	Q9NZ71	3.69e-60	226	1219	0.198	0.154	RTEL1_HUMAN Regulator of telomere elongation helicase 1 OS=Homo sapiens OX=9606 GN=RTEL1 PE=1 SV=2
17	F4HUN4	3.07e-58	220	1175	0.192	0.155	F4HUN4_ARATH RAD3-like DNA-binding helicase protein OS=Arabidopsis thaliana OX=3702 GN=At1g20720 PE=1 SV=1
18	R4GNE1	4.37e-54	184	91	0.093	0.967	R4GNE1_HUMAN DEAD/H-box helicase 11 (Fragment) OS=Homo sapiens OX=9606 GN=DDX11 PE=4 SV=1
19	F4HQE2	1.43e-52	202	1040	0.182	0.166	RTEL1_ARATH Regulator of telomere elongation helicase 1 homolog OS=Arabidopsis thaliana OX=3702 GN=RTEL1 PE=3 SV=1
20	P26659	7.68e-48	185	772	0.175	0.215	RAD15_SCHPO General transcription and DNA repair factor IIH helicase subunit XPD OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rad15 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13401 AAA_22	9.5e+02	11.5	AAA domain
2	PF06733 DEAD_2	6.4e-52	187.2	DEAD_2
3	PF06777 HBB	1.4	20.1	Helical and beta-bridge domain
4	PF13307 Helicase_C_2	5e-51	184.8	Helicase C-terminal domain
5	PF02562 PhoH	77	14.2	PhoH-like protein
6	PF04851 ResIII	18	16.8	Type III restriction enzyme, res subunit

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000003551

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000010263	0.861	CTF18, chromosome transmission fidelity factor 18 homolog (S. cerevisiae)
2	61853.ENSNLEP00000003783	0.854	Flap endonuclease 1
3	61853.ENSNLEP00000007107	0.809	ATPase family, AAA domain containing 5
4	61853.ENSNLEP00000014614	0.798	Werner syndrome, RecQ helicase-like
5	61853.ENSNLEP00000006066	0.776	DNA replication and sister chromatid cohesion 1
6	61853.ENSNLEP00000015520	0.754	WD repeat and HMG-box DNA binding protein 1
7	61853.ENSNLEP00000008308	0.742	Establishment of sister chromatid cohesion N-acetyltransferase 1
8	61853.ENSNLEP00000021231	0.736	Timeless circadian clock
9	61853.ENSNLEP00000019016	0.721	ERCC excision repair 3, TFIIH core complex helicase subunit
10	61853.ENSNLEP00000002186	0.715	GEN1 Holliday junction 5' flap endonuclease
11	61853.ENSNLEP00000020760	0.707	Replication factor C (activator 1) 1, 145kDa
12	61853.ENSNLEP00000020060	0.700	Establishment of sister chromatid cohesion N-acetyltransferase 2
13	61853.ENSNLEP00000005335	0.698	Uncharacterized protein
14	61853.ENSNLEP00000015666	0.692	Plays an important role in the control of DNA replication and the maintenance of replication fork stability.
15	61853.ENSNLEP00000018841	0.691	Structural maintenance of chromosomes 3
16	61853.ENSNLEP00000006799	0.690	General transcription factor IIH subunit 4
17	61853.ENSNLEP00000016742	0.690	MNAT CDK-activating kinase assembly factor 1
18	61853.ENSNLEP00000021572	0.688	General transcription factor IIH, polypeptide 1, 62kDa
19	61853.ENSNLEP00000002325	0.685	General transcription factor IIH, polypeptide 3, 34kDa
20	61853.ENSNLEP00000014129	0.685	F-box protein, helicase, 18

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0003678	0.999	DNA helicase activity
GO:0043139	0.962	5'-3' DNA helicase activity
GO:0097159	0.947	organic cyclic compound binding
GO:1901363	0.946	heterocyclic compound binding
GO:0003676	0.792	nucleic acid binding
GO:0003677	0.638	DNA binding
GO:0003682	0.593	chromatin binding
GO:0003727	0.335	single-stranded RNA binding
GO:0008186	0.323	ATP-dependent activity, acting on RNA

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.996	biological regulation
GO:0050794	0.992	regulation of cellular process
GO:0090304	0.985	nucleic acid metabolic process
GO:0016043	0.936	cellular component organization
GO:0048522	0.926	positive regulation of cellular process
GO:0019222	0.846	regulation of metabolic process
GO:0044260	0.817	cellular macromolecule metabolic process
GO:0031323	0.805	regulation of cellular metabolic process
GO:0051171	0.796	regulation of nitrogen compound metabolic process
GO:0019219	0.789	regulation of nucleobase-containing compound metabolic process
GO:0051052	0.766	regulation of DNA metabolic process
GO:0006996	0.759	organelle organization
GO:0031326	0.686	regulation of cellular biosynthetic process
GO:0010556	0.684	regulation of macromolecule biosynthetic process
GO:0009893	0.674	positive regulation of metabolic process
GO:0050896	0.625	response to stimulus
GO:0006259	0.618	DNA metabolic process
GO:0010468	0.590	regulation of gene expression
GO:0051173	0.563	positive regulation of nitrogen compound metabolic process
GO:0031325	0.563	positive regulation of cellular metabolic process
GO:0045935	0.535	positive regulation of nucleobase-containing compound metabolic process
GO:0006355	0.533	regulation of DNA-templated transcription
GO:0051276	0.501	chromosome organization
GO:0006974	0.477	cellular response to DNA damage stimulus
GO:0080135	0.465	regulation of cellular response to stress
GO:0006260	0.346	DNA replication
GO:2001020	0.341	regulation of response to DNA damage stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043232	0.999	intracellular non-membrane-bounded organelle
GO:0005654	0.999	nucleoplasm
GO:0032991	0.965	protein-containing complex
GO:0005694	0.771	chromosome
GO:0005737	0.630	cytoplasm
GO:0005856	0.606	cytoskeleton
GO:0005815	0.525	microtubule organizing center
GO:0005730	0.405	nucleolus
GO:0005819	0.387	spindle
GO:0005813	0.375	centrosome
GO:0005829	0.309	cytosol
GO:0140513	0.306	nuclear protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:5.6.2.3	0.962	DNA 5'-3' helicase.

[back to server]