StarFunc result for job id Q92785

User Input

>input (391 residues)
MAAVVENVVKLLGEQYYKDAMEQCHNYNARLCAERSVRLPFLDSQTGVAQSNCYIWMEKR
HRGPGLASGQLYSYPARRWRKKRRAHPPEDPRLSFPSIKPDTDQTLKKEGLISQDGSSLE
ALLRTDPLEKRGAPDPRVDDDSLGEFPVTNSRARKRILEPDDFLDDLDDEDYEEDTPKRR
GKGKSKGKGVGSARKKLDASILEDRDKPYACDICGKRYKNRPGLSYHYAHSHLAEEEGED
KEDSQPPTPVSQRSEEQKSKKGPDGLALPNNYCDFCLGDSKINKKTGQPEELVSCSDCGR
SGHPSCLQFTPVMMAAVKTYRWQCIECKCCNICGTSENDDQLLFCDDCDRGYHMYCLTPS
MSEPPEGSWSCHLCLDLLKEKASIYQNQNSS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:J3KMZ8	0.348	0.336	2.108E-65	405	0.997	0.963	J3KMZ8.pdb.gz	J3KMZ8_HUMAN Double PHD fingers 2 OS=Homo sapiens OX=9606 GN=DPF2 PE=1 SV=1
2	AFDB:A9LMC0	0.338	0.338	8.809E-44	391	0.591	0.591	A9LMC0.pdb.gz	DPF3_DANRE Zinc finger protein DPF3 OS=Danio rerio OX=7955 GN=dpf3 PE=2 SV=1
3	AFDB:P56163	0.313	0.308	1.791E-43	397	0.604	0.594	P56163.pdb.gz	DPF1_RAT Zinc finger protein neuro-d4 OS=Rattus norvegicus OX=10116 GN=Dpf1 PE=2 SV=1
4	AFDB:Q7K3G5	0.287	0.227	5.461E-25	497	0.435	0.342	Q7K3G5.pdb.gz	Q7K3G5_DROME D4, isoform A OS=Drosophila melanogaster OX=7227 GN=d4 PE=1 SV=1
5	AFDB:Q09477	0.301	0.316	3.852E-23	372	0.304	0.320	Q09477.pdb.gz	DPFF1_CAEEL Zinc finger protein dpff-1 OS=Caenorhabditis elegans OX=6239 GN=dpff-1 PE=2 SV=2
6	AFDB:Q8WUB8	0.260	0.205	2.352E-15	498	0.246	0.193	Q8WUB8.pdb.gz	PHF10_HUMAN PHD finger protein 10 OS=Homo sapiens OX=9606 GN=PHF10 PE=1 SV=3
7	AFDB:Q8WYB5	0.272	0.054	2.759E-10	2073	0.212	0.040	Q8WYB5.pdb.gz	KAT6B_HUMAN Histone acetyltransferase KAT6B OS=Homo sapiens OX=9606 GN=KAT6B PE=1 SV=3
8	PDB:6lthR	0.112	0.523	7.160E-10	70	0.176	0.986	6lthR.pdb.gz	Structure of nucleosome-bound human BAF complex.
9	AFDB:G5EGI1	0.215	0.039	2.898E-4	2475	0.171	0.027	G5EGI1.pdb.gz	G5EGI1_CAEEL PHD-type domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=set-16 PE=1 SV=1
10	AFDB:F4KE59	0.135	0.042	3.360E-3	1311	0.166	0.050	F4KE59.pdb.gz	PAIP2_ARATH Protein PARALOG OF AIPP2 OS=Arabidopsis thaliana OX=3702 GN=PAIPP2 PE=1 SV=1
11	AFDB:Q6E2N3	0.104	0.036	8.287E-3	1163	0.179	0.060	Q6E2N3.pdb.gz	TRI33_DANRE E3 ubiquitin-protein ligase TRIM33 OS=Danio rerio OX=7955 GN=trim33 PE=2 SV=1
12	PDB:1b8tA	0.082	0.147	4.456E-1	192	0.072	0.146	1b8tA.pdb.gz	Solution structure of the chicken cysteine-rich protein, CRP1, a double-LIM protein implicated in muscle differentiation.
13	PDB:7uhyA	0.073	0.040	6.998E-1	771	0.041	0.021	7uhyA.pdb.gz	Structure of the nutrient-sensing hub GATOR2.
14	PDB:8a3tU	0.095	0.275	7.464E-1	114	0.038	0.132	8a3tU.pdb.gz	Cryo-EM structure of the S. cerevisiae APC/C-Cdh1 complex
15	PDB:7uhyC	0.073	0.055	7.961E-1	578	0.031	0.021	7uhyC.pdb.gz	Structure of the nutrient-sensing hub GATOR2.
16	PDB:7uhyD	0.073	0.091	9.661E-1	288	0.049	0.066	7uhyD.pdb.gz	Structure of the nutrient-sensing hub GATOR2.
17	PDB:4kfzB	0.067	0.160	1.250	148	0.049	0.128	4kfzB.pdb.gz	Conformational flexibility of the oncogenic protein LMO2 primes the formation of the multi-protein transcription complex.
18	PDB:7oqyY	0.062	0.153	1.250	92	0.036	0.152	7oqyY.pdb.gz	Structural basis of RNA polymerase inhibition by viral and host factors.
19	PDB:4msxA	0.070	0.070	2.234	395	0.028	0.028	4msxA.pdb.gz	The crystal structure of S. cerevisiae Sad1, a catalytically inactive deubiquitinase that is broadly required for pre-mRNA splicing.
20	PDB:7oniR	0.085	0.293	2.234	86	0.020	0.093	7oniR.pdb.gz	CUL5-ARIH2 E3-E3 ubiquitin ligase structure reveals cullin-specific NEDD8 activation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	J3KMZ8	0.0	799	405	0.997	0.963	J3KMZ8_HUMAN Double PHD fingers 2 OS=Homo sapiens OX=9606 GN=DPF2 PE=1 SV=1
2	Q61103	0.0	799	391	0.985	0.985	REQU_MOUSE Zinc finger protein ubi-d4 OS=Mus musculus OX=10090 GN=Dpf2 PE=1 SV=1
3	Q92785	0.0	808	391	1.000	1.000	REQU_HUMAN Zinc finger protein ubi-d4 OS=Homo sapiens OX=9606 GN=DPF2 PE=1 SV=2
4	P58269	1.41e-175	496	378	0.621	0.643	DPF3_MOUSE Zinc finger protein DPF3 OS=Mus musculus OX=10090 GN=Dpf3 PE=1 SV=2
5	Q92784	1.85e-175	495	378	0.621	0.643	DPF3_HUMAN Zinc finger protein DPF3 OS=Homo sapiens OX=9606 GN=DPF3 PE=1 SV=3
6	A9LMC0	3.46e-158	452	391	0.611	0.611	DPF3_DANRE Zinc finger protein DPF3 OS=Danio rerio OX=7955 GN=dpf3 PE=2 SV=1
7	Q9QX66	3.50e-154	442	387	0.591	0.597	DPF1_MOUSE Zinc finger protein neuro-d4 OS=Mus musculus OX=10090 GN=Dpf1 PE=1 SV=2
8	Q92782	4.76e-153	439	387	0.591	0.597	DPF1_HUMAN Zinc finger protein neuro-d4 OS=Homo sapiens OX=9606 GN=DPF1 PE=1 SV=3
9	P56163	5.65e-151	434	397	0.593	0.584	DPF1_RAT Zinc finger protein neuro-d4 OS=Rattus norvegicus OX=10116 GN=Dpf1 PE=2 SV=1
10	F8W7T1	1.71e-113	339	412	0.442	0.420	F8W7T1_HUMAN Double PHD fingers 3 OS=Homo sapiens OX=9606 GN=DPF3 PE=1 SV=1
11	Q09477	4.30e-59	198	372	0.350	0.368	DPFF1_CAEEL Zinc finger protein dpff-1 OS=Caenorhabditis elegans OX=6239 GN=dpff-1 PE=2 SV=2
12	Q7K3G5	7.06e-58	198	497	0.217	0.171	Q7K3G5_DROME D4, isoform A OS=Drosophila melanogaster OX=7227 GN=d4 PE=1 SV=1
13	Q8BZ21	1.70e-33	135	2003	0.161	0.031	KAT6A_MOUSE Histone acetyltransferase KAT6A OS=Mus musculus OX=10090 GN=Kat6a PE=1 SV=2
14	M0R4T9	1.87e-33	134	1857	0.166	0.035	M0R4T9_RAT histone acetyltransferase OS=Rattus norvegicus OX=10116 GN=Kat6b PE=3 SV=3
15	A0A8I6GLZ3	2.13e-33	134	2039	0.166	0.032	A0A8I6GLZ3_RAT histone acetyltransferase OS=Rattus norvegicus OX=10116 GN=Kat6b PE=3 SV=1
16	Q8BRB7	5.52e-33	133	1872	0.164	0.034	KAT6B_MOUSE Histone acetyltransferase KAT6B OS=Mus musculus OX=10090 GN=Kat6b PE=1 SV=3
17	A0A3B3IS53	7.56e-33	133	1677	0.146	0.034	A0A3B3IS53_HUMAN Histone acetyltransferase (Fragment) OS=Homo sapiens OX=9606 GN=KAT6A PE=1 SV=1
18	A0A3F2YNX6	7.84e-33	133	2006	0.156	0.030	A0A3F2YNX6_HUMAN Histone acetyltransferase OS=Homo sapiens OX=9606 GN=KAT6A PE=1 SV=1
19	Q92794	7.84e-33	133	2004	0.156	0.030	KAT6A_HUMAN Histone acetyltransferase KAT6A OS=Homo sapiens OX=9606 GN=KAT6A PE=1 SV=2
20	Q8WYB5	1.92e-32	132	2073	0.161	0.030	KAT6B_HUMAN Histone acetyltransferase KAT6B OS=Homo sapiens OX=9606 GN=KAT6B PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14051 DPF1-3_N	4.3e-34	127.8	DPF1-3, N-terminal
2	PF00628 PHD	6.6e-17	72.5	PHD-finger
3	PF16866 PHD_4	20	16.7	PHD-finger
4	PF00096 zf-C2H2	3.1e+02	13.2	Zinc finger, C2H2 type
5	PF13894 zf-C2H2_4	78	15.5	C2H2-type zinc finger
6	PF13465 zf-H2C2_2	7.6e+02	12.0	Zinc-finger double domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000006764

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000000633	0.992	SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily b, member 1
2	61853.ENSNLEP00000002500	0.986	SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily e, member 1
3	61853.ENSNLEP00000015131	0.981	SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 4
4	61853.ENSNLEP00000011400	0.980	AT rich interactive domain 1A (SWI-like)
5	61853.ENSNLEP00000021627	0.979	SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 1
6	61853.ENSNLEP00000021282	0.977	SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily c, member 2
7	61853.ENSNLEP00000007734	0.966	SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily c, member 1
8	61853.ENSNLEP00000019134	0.956	SS18L1, nBAF chromatin remodeling complex subunit
9	61853.ENSNLEP00000019002	0.948	AT rich interactive domain 1B (SWI1-like)
10	61853.ENSNLEP00000007986	0.940	SS18, nBAF chromatin remodeling complex subunit
11	61853.ENSNLEP00000007056	0.920	Actin-like 6A
12	61853.ENSNLEP00000005368	0.913	SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 3
13	61853.ENSNLEP00000005008	0.912	SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 2
14	61853.ENSNLEP00000014469	0.906	Actin-like 6B
15	61853.ENSNLEP00000001627	0.886	BCL tumor suppressor 7A
16	61853.ENSNLEP00000010890	0.883	BCL tumor suppressor 7B
17	61853.ENSNLEP00000010477	0.875	SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 2
18	61853.ENSNLEP00000023571	0.875	Uncharacterized protein
19	61853.ENSNLEP00000019460	0.869	BCL tumor suppressor 7C
20	61853.ENSNLEP00000001015	0.796	Bromodomain containing 7

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0140110	0.864	transcription regulator activity
GO:0003676	0.836	nucleic acid binding
GO:0003677	0.827	DNA binding
GO:0003712	0.801	transcription coregulator activity
GO:0043565	0.693	sequence-specific DNA binding
GO:0042393	0.675	histone binding
GO:0140030	0.637	modification-dependent protein binding
GO:0140034	0.621	methylation-dependent protein binding
GO:0035064	0.499	methylated histone binding
GO:0140033	0.491	acetylation-dependent protein binding
GO:0070577	0.425	lysine-acetylated histone binding
GO:0003682	0.393	chromatin binding
GO:0003714	0.327	transcription corepressor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.987	cellular process
GO:0010468	0.979	regulation of gene expression
GO:1903506	0.975	regulation of nucleic acid-templated transcription
GO:0006355	0.967	regulation of DNA-templated transcription
GO:0048519	0.932	negative regulation of biological process
GO:0048523	0.865	negative regulation of cellular process
GO:0009890	0.837	negative regulation of biosynthetic process
GO:0010605	0.836	negative regulation of macromolecule metabolic process
GO:0045934	0.832	negative regulation of nucleobase-containing compound metabolic process
GO:0031327	0.831	negative regulation of cellular biosynthetic process
GO:0010558	0.829	negative regulation of macromolecule biosynthetic process
GO:0050896	0.826	response to stimulus
GO:0045892	0.818	negative regulation of DNA-templated transcription
GO:0006915	0.749	apoptotic process
GO:0023052	0.735	signaling
GO:0051716	0.706	cellular response to stimulus
GO:1901532	0.694	regulation of hematopoietic progenitor cell differentiation
GO:0007154	0.604	cell communication
GO:0006357	0.529	regulation of transcription by RNA polymerase II
GO:0032502	0.501	developmental process
GO:0032501	0.494	multicellular organismal process
GO:0007165	0.317	signal transduction
GO:0048518	0.316	positive regulation of biological process
GO:0048856	0.312	anatomical structure development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043232	1.000	intracellular non-membrane-bounded organelle
GO:0005654	1.000	nucleoplasm
GO:0005737	0.996	cytoplasm
GO:0005829	0.992	cytosol
GO:0032991	0.958	protein-containing complex
GO:0005694	0.925	chromosome
GO:0140513	0.925	nuclear protein-containing complex
GO:0005856	0.892	cytoskeleton
GO:0000785	0.884	chromatin
GO:1902494	0.883	catalytic complex
GO:0005815	0.880	microtubule organizing center
GO:0005813	0.835	centrosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]