StarFunc result for job id Q92786

User Input

>input (737 residues)
MPDHDSTALLSRQTKRRRVDIGVKRTVGTASAFFAKARATFFSAMNPQGSEQDVEYSVVQ
HADGEKSNVLRKLLKRANSYEDAMMPFPGATIISQLLKNNMNKNGGTEPSFQASGLSSTG
SEVHQEDICSNSSRDSPPECLSPFGRPTMSQFDMDRLCDEHLRAKRARVENIIRGMSHSP
SVALRGNENEREMAPQSVSPRESYRENKRKQKLPQQQQQSFQQLVSARKEQKREERRQLK
QQLEDMQKQLRQLQEKFYQIYDSTDSENDEDGNLSEDSMRSEILDARAQDSVGRSDNEMC
ELDPGQFIDRARALIREQEMAENKPKREGNNKERDHGPNSLQPEGKHLAETLKQELNTAM
SQVVDTVVKVFSAKPSRQVPQVFPPLQIPQARFAVNGENHNFHTANQRLQCFGDVIIPNP
LDTFGNVQMASSTDQTEALPLVVRKNSSDQSASGPAAGGHHQPLHQSPLSATTGFTTSTF
RHPFPLPLMAYPFQSPLGAPSGSFSGKDRASPESLDLTRDTTSLRTKMSSHHLSHHPCSP
AHPPSTAEGLSLSLIKSECGDLQDMSEISPYSGSAMQEGLSPNHLKKAKLMFFYTRYPSS
NMLKTYFSDVKFNRCITSQLIKWFSNFREFYYIQMEKYARQAINDGVTSTEELSITRDCE
LYRALNMHYNKANDFEVPERFLEVAQITLREFFNAIIAGKDVDPSWKKAIYKVICKLDSE
VPEIFKSPNCLQELLHE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:F1QAE1	0.306	0.305	1.937E-76	739	0.829	0.827	F1QAE1.pdb.gz	F1QAE1_DANRE Prospero homeobox 1a OS=Danio rerio OX=7955 GN=prox1 PE=4 SV=1
2	AFDB:D2DHG1	0.211	0.235	6.287E-24	659	0.294	0.329	D2DHG1.pdb.gz	D2DHG1_DANRE Prospero homeobox 3 OS=Danio rerio OX=7955 GN=prox1b PE=2 SV=1
3	AFDB:E7EZE5	0.087	0.057	1.525E-3	1252	0.134	0.079	E7EZE5.pdb.gz	E7EZE5_DANRE IQ motif and SEC7 domain-containing protein 1 isoform X1 OS=Danio rerio OX=7955 GN=iqsec1b PE=1 SV=1
4	AFDB:D3ZD05	0.077	0.070	2.607E-3	847	0.160	0.139	D3ZD05.pdb.gz	KANK2_RAT KN motif and ankyrin repeat domain-containing protein 2 OS=Rattus norvegicus OX=10116 GN=Kank2 PE=1 SV=2
5	AFDB:A0A3B3IRZ4	0.090	0.061	3.597E-3	1222	0.136	0.082	A0A3B3IRZ4.pdb.gz	A0A3B3IRZ4_HUMAN IQ motif and Sec7 domain ArfGEF 1 OS=Homo sapiens OX=9606 GN=IQSEC1 PE=1 SV=1
6	AFDB:Q8K0L9	0.056	0.055	1.235E-2	741	0.138	0.138	Q8K0L9.pdb.gz	ZBT20_MOUSE Zinc finger and BTB domain-containing protein 20 OS=Mus musculus OX=10090 GN=Zbtb20 PE=1 SV=1
7	AFDB:P15330	0.065	0.051	1.616E-2	999	0.091	0.067	P15330.pdb.gz	DORS_DROME Embryonic polarity protein dorsal OS=Drosophila melanogaster OX=7227 GN=dl PE=1 SV=2
8	AFDB:Q9VU85	0.067	0.084	2.352E-2	535	0.099	0.136	Q9VU85.pdb.gz	Q9VU85_DROME Tondu-domain-containing growth inhibitor, isoform A OS=Drosophila melanogaster OX=7227 GN=Tgi PE=4 SV=1
9	AFDB:Q5VXU9	0.063	0.044	4.243E-2	1444	0.141	0.072	Q5VXU9.pdb.gz	SHOC1_HUMAN Protein shortage in chiasmata 1 ortholog OS=Homo sapiens OX=9606 GN=SHOC1 PE=1 SV=1
10	AFDB:Q57X11	0.065	0.061	4.984E-2	918	0.122	0.098	Q57X11.pdb.gz	Q57X11_TRYB2 Recombination initiation protein NBS1, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.26E13.400 PE=4 SV=1
11	PDB:7nsba	0.056	0.068	6.730E-1	568	0.041	0.053	7nsba.pdb.gz
12	PDB:1jr3D	0.086	0.154	7.905E-1	338	0.033	0.071	1jr3D.pdb.gz	Crystal structure of the processivity clamp loader gamma (gamma) complex of E. coli DNA polymerase III.
13	PDB:3hf4F	0.078	0.224	1.091	146	0.026	0.130	3hf4F.pdb.gz	Quaternary structural variability in rat hemoglobin
14	PDB:7nsbh	0.078	0.177	1.281	247	0.030	0.089	7nsbh.pdb.gz
15	PDB:3hrwA	0.069	0.191	2.438	141	0.030	0.156	3hrwA.pdb.gz	Crystal structure of hemoglobin from mouse (Mus musculus) compared with those from other small animals and humans.
16	PDB:1hbrD	0.090	0.244	2.573	146	0.019	0.096	1hbrD.pdb.gz	The structural and functional analysis of the hemoglobin D component from chicken.
17	PDB:3hf4A	0.063	0.218	2.715	141	0.023	0.121	3hf4A.pdb.gz	Quaternary structural variability in rat hemoglobin
18	PDB:7wffh	0.059	0.203	3.022	145	0.023	0.117	7wffh.pdb.gz	Supramolecular assembly of chloroplast NADH dehydrogenase-like complex with photosystem I from Arabidopsis thaliana.
19	PDB:1c1kA	0.078	0.169	3.745	217	0.020	0.069	1c1kA.pdb.gz
20	PDB:7lsyY	0.063	0.057	4.898	855	0.039	0.034	7lsyY.pdb.gz	Structural basis of long-range to short-range synaptic transition in NHEJ.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I6A8R7	0.0	1210	628	0.817	0.959	A0A8I6A8R7_RAT Prospero homeobox 1 OS=Rattus norvegicus OX=10116 GN=Prox1 PE=1 SV=1
2	D3ZU00	0.0	1519	737	0.985	0.985	D3ZU00_RAT Prospero homeobox 1 OS=Rattus norvegicus OX=10116 GN=Prox1 PE=1 SV=3
3	F1QAE1	0.0	1203	739	0.830	0.828	F1QAE1_DANRE Prospero homeobox 1a OS=Danio rerio OX=7955 GN=prox1 PE=4 SV=1
4	P48437	0.0	1518	737	0.984	0.984	PROX1_MOUSE Prospero homeobox protein 1 OS=Mus musculus OX=10090 GN=Prox1 PE=1 SV=2
5	Q90ZL7	0.0	1205	739	0.832	0.829	Q90ZL7_DANRE Prospero homeobox protein 1 OS=Danio rerio OX=7955 GN=zgc:111888 PE=2 SV=1
6	Q91018	0.0	1421	736	0.936	0.938	PROX1_CHICK Prospero homeobox protein 1 OS=Gallus gallus OX=9031 GN=PROX1 PE=2 SV=1
7	Q92786	0.0	1538	737	1.000	1.000	PROX1_HUMAN Prospero homeobox protein 1 OS=Homo sapiens OX=9606 GN=PROX1 PE=1 SV=2
8	C9JU29	5.91e-165	476	230	0.312	1.000	C9JU29_HUMAN Prospero homeobox 1 (Fragment) OS=Homo sapiens OX=9606 GN=PROX1 PE=1 SV=1
9	U3KPY6	7.09e-97	298	143	0.194	1.000	U3KPY6_HUMAN Prospero homeobox 1 (Fragment) OS=Homo sapiens OX=9606 GN=PROX1 PE=1 SV=1
10	D2DHG1	2.39e-82	277	659	0.281	0.314	D2DHG1_DANRE Prospero homeobox 3 OS=Danio rerio OX=7955 GN=prox1b PE=2 SV=1
11	P34522	8.65e-62	219	594	0.130	0.162	PROS1_CAEEL Homeobox protein prospero homolog 1 OS=Caenorhabditis elegans OX=6239 GN=pros-1 PE=2 SV=2
12	P29617	2.41e-61	226	1703	0.132	0.057	PROS_DROME Homeobox protein prospero OS=Drosophila melanogaster OX=7227 GN=pros PE=1 SV=3
13	O75781	0.71	35.4	387	0.047	0.090	PALM_HUMAN Paralemmin-1 OS=Homo sapiens OX=9606 GN=PALM PE=1 SV=2
14	Q388B7	0.82	35.4	820	0.034	0.030	Q388B7_TRYB2 Kinesin-like protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.61.1750 PE=3 SV=1
15	Q8C1F4	1.2	34.7	542	0.037	0.050	CGAT2_MOUSE Chondroitin sulfate N-acetylgalactosaminyltransferase 2 OS=Mus musculus OX=10090 GN=Csgalnact2 PE=2 SV=1
16	Q08E86	2.4	34.3	2092	0.030	0.011	Q08E86_HUMAN Bridge-like lipid transfer protein family member 2 OS=Homo sapiens OX=9606 GN=BLTP2 PE=1 SV=1
17	P0CI65	3.0	33.9	1303	0.039	0.022	NPHP3_DANRE Nephrocystin-3 OS=Danio rerio OX=7955 GN=nphp3 PE=3 SV=1
18	Q8CIS0	4.2	33.1	1159	0.061	0.039	CAR11_MOUSE Caspase recruitment domain-containing protein 11 OS=Mus musculus OX=10090 GN=Card11 PE=1 SV=2
19	Q9QXN0	5.5	33.1	1986	0.045	0.017	SHRM3_MOUSE Protein Shroom3 OS=Mus musculus OX=10090 GN=Shroom3 PE=1 SV=2
20	E7F6G2	7.0	32.3	580	0.024	0.031	E7F6G2_DANRE Hexosyltransferase OS=Danio rerio OX=7955 GN=csgalnact1a PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05044 HPD	3.9e-85	294.9	Homeo-prospero domain
2	PF13801 Metal_resist	1.5e+02	14.0	Heavy-metal resistance
3	PF04891 NifQ	1.7e+02	14.0	NifQ

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000017553

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000005464	0.751	HUS1 checkpoint homolog (S. pombe)
2	61853.ENSNLEP00000021951	0.748	Nuclear receptor subfamily 5, group A, member 2
3	61853.ENSNLEP00000008037	0.744	Hepatocyte nuclear factor 4, alpha
4	61853.ENSNLEP00000021362	0.676	Lymphatic vessel endothelial hyaluronan receptor 1
5	61853.ENSNLEP00000003032	0.617	Fms-related tyrosine kinase 4
6	61853.ENSNLEP00000020420	0.616	Vascular endothelial growth factor C
7	61853.ENSNLEP00000021500	0.609	INSC, spindle orientation adaptor protein
8	61853.ENSNLEP00000012038	0.586	Podoplanin
9	61853.ENSNLEP00000018748	0.576	E1A binding protein p300
10	61853.ENSNLEP00000003157	0.554	Ribosomal protein S6 kinase, 90kDa, polypeptide 6
11	61853.ENSNLEP00000015072	0.554	Nuclear receptor subfamily 2, group F, member 2
12	61853.ENSNLEP00000016870	0.554	Nuclear receptor subfamily 2, group F, member 1
13	61853.ENSNLEP00000021731	0.554	Paired box 6
14	61853.ENSNLEP00000002344	0.538	Hepatocyte nuclear factor 4, gamma
15	61853.ENSNLEP00000015220	0.534	Uncharacterized protein
16	61853.ENSNLEP00000012465	0.532	SRY-box 18
17	61853.ENSNLEP00000001925	0.531	Forkhead box N4
18	61853.ENSNLEP00000001842	0.506	Staufen double-stranded RNA binding protein 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0000981	1.000	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000976	1.000	transcription cis-regulatory region binding
GO:0000987	0.527	cis-regulatory region sequence-specific DNA binding
GO:0000977	0.492	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000978	0.401	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0008134	0.400	transcription factor binding
GO:0140297	0.359	DNA-binding transcription factor binding
GO:0001217	0.353	DNA-binding transcription repressor activity
GO:0061629	0.338	RNA polymerase II-specific DNA-binding transcription factor binding
GO:0001227	0.311	DNA-binding transcription repressor activity, RNA polymerase II-specific

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032501	0.996	multicellular organismal process
GO:0061008	0.994	hepaticobiliary system development
GO:0009987	0.992	cellular process
GO:0048869	0.982	cellular developmental process
GO:0050794	0.981	regulation of cellular process
GO:0009888	0.973	tissue development
GO:0030154	0.965	cell differentiation
GO:0048732	0.964	gland development
GO:0060255	0.944	regulation of macromolecule metabolic process
GO:0031323	0.944	regulation of cellular metabolic process
GO:0051171	0.943	regulation of nitrogen compound metabolic process
GO:0080090	0.942	regulation of primary metabolic process
GO:0007420	0.937	brain development
GO:0009889	0.936	regulation of biosynthetic process
GO:0031326	0.933	regulation of cellular biosynthetic process
GO:0019219	0.931	regulation of nucleobase-containing compound metabolic process
GO:0001889	0.928	liver development
GO:0010556	0.920	regulation of macromolecule biosynthetic process
GO:0051252	0.917	regulation of RNA metabolic process
GO:0010468	0.913	regulation of gene expression
GO:2001141	0.902	regulation of RNA biosynthetic process
GO:0006355	0.892	regulation of DNA-templated transcription
GO:0009653	0.871	anatomical structure morphogenesis
GO:0048519	0.866	negative regulation of biological process
GO:0048523	0.857	negative regulation of cellular process
GO:0050896	0.823	response to stimulus
GO:0048518	0.784	positive regulation of biological process
GO:0072359	0.764	circulatory system development
GO:0001944	0.585	vasculature development
GO:0065009	0.552	regulation of molecular function
GO:0048522	0.513	positive regulation of cellular process
GO:0040012	0.452	regulation of locomotion
GO:0009893	0.451	positive regulation of metabolic process
GO:0010604	0.428	positive regulation of macromolecule metabolic process
GO:2000145	0.421	regulation of cell motility
GO:0007423	0.419	sensory organ development
GO:0048880	0.405	sensory system development
GO:0048646	0.401	anatomical structure formation involved in morphogenesis
GO:0051173	0.399	positive regulation of nitrogen compound metabolic process
GO:0001945	0.389	lymph vessel development
GO:0060429	0.380	epithelium development
GO:0048468	0.375	cell development
GO:0009892	0.357	negative regulation of metabolic process
GO:0031325	0.357	positive regulation of cellular metabolic process
GO:0006357	0.347	regulation of transcription by RNA polymerase II
GO:0030334	0.338	regulation of cell migration
GO:0071840	0.315	cellular component organization or biogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0005737	0.988	cytoplasm
GO:0070013	0.922	intracellular organelle lumen
GO:0005654	0.487	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]