StarFunc result for job id Q92793

User Input

>input (2442 residues)
MAENLLDGPPNPKRAKLSSPGFSANDSTDFGSLFDLENDLPDELIPNGGELGLLNSGNLV
PDAASKHKQLSELLRGGSGSSINPGIGNVSASSPVQQGLGGQAQGQPNSANMASLSAMGK
SPLSQGDSSAPSLPKQAASTSGPTPAASQALNPQAQKQVGLATSSPATSQTGPGICMNAN
FNQTHPGLLNSNSGHSLINQASQGQAQVMNGSLGAAGRGRGAGMPYPTPAMQGASSSVLA
ETLTQVSPQMTGHAGLNTAQAGGMAKMGITGNTSPFGQPFSQAGGQPMGATGVNPQLASK
QSMVNSLPTFPTDIKNTSVTNVPNMSQMQTSVGIVPTQAIATGPTADPEKRKLIQQQLVL
LLHAHKCQRREQANGEVRACSLPHCRTMKNVLNHMTHCQAGKACQVAHCASSRQIISHWK
NCTRHDCPVCLPLKNASDKRNQQTILGSPASGIQNTIGSVGTGQQNATSLSNPNPIDPSS
MQRAYAALGLPYMNQPQTQLQPQVPGQQPAQPQTHQQMRTLNPLGNNPMNIPAGGITTDQ
QPPNLISESALPTSLGATNPLMNDGSNSGNIGTLSTIPTAAPPSSTGVRKGWHEHVTQDL
RSHLVHKLVQAIFPTPDPAALKDRRMENLVAYAKKVEGDMYESANSRDEYYHLLAEKIYK
IQKELEEKRRSRLHKQGILGNQPALPAPGAQPPVIPQAQPVRPPNGPLSLPVNRMQVSQG
MNSFNPMSLGNVQLPQAPMGPRAASPMNHSVQMNSMGSVPGMAISPSRMPQPPNMMGAHT
NNMMAQAPAQSQFLPQNQFPSSSGAMSVGMGQPPAQTGVSQGQVPGAALPNPLNMLGPQA
SQLPCPPVTQSPLHPTPPPASTAAGMPSLQHTTPPGMTPPQPAAPTQPSTPVSSSGQTPT
PTPGSVPSATQTQSTPTVQAAAQAQVTPQPQTPVQPPSVATPQSSQQQPTPVHAQPPGTP
LSQAAASIDNRVPTPSSVASAETNSQQPGPDVPVLEMKTETQAEDTEPDPGESKGEPRSE
MMEEDLQGASQVKEETDIAEQKSEPMEVDEKKPEVKVEVKEEEESSSNGTASQSTSPSQP
RKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKR
KLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSLGYCC
GRKYEFSPQTLCCYGKQLCTIPRDAAYYSYQNRYHFCEKCFTEIQGENVTLGDDPSQPQT
TISKDQFEKKKNDTLDPEPFVDCKECGRKMHQICVLHYDIIWPSGFVCDNCLKKTGRPRK
ENKFSAKRLQTTRLGNHLEDRVNKFLRRQNHPEAGEVFVRVVASSDKTVEVKPGMKSRFV
DSGEMSESFPYRTKALFAFEEIDGVDVCFFGMHVQEYGSDCPPPNTRRVYISYLDSIHFF
RPRCLRTAVYHEILIGYLEYVKKLGYVTGHIWACPPSEGDDYIFHCHPPDQKIPKPKRLQ
EWYKKMLDKAFAERIIHDYKDIFKQATEDRLTSAKELPYFEGDFWPNVLEESIKELEQEE
EERKKEESTAASETTEGSQGDSKNAKKKNNKKTNKNKSSISRANKKKPSMPNVSNDLSQK
LYATMEKHKEVFFVIHLHAGPVINTLPPIVDPDPLLSCDLMDGRDAFLTLARDKHWEFSS
LRRSKWSTLCMLVELHTQGQDRFVYTCNECKHHVETRWHCTVCEDYDLCINCYNTKSHAH
KMVKWGLGLDDEGSSQGEPQSKSPQESRRLSIQRCIQSLVHACQCRNANCSLPSCQKMKR
VVQHTKGCKRKTNGGCPVCKQLIALCCYHAKHCQENKCPVPFCLNIKHKLRQQQIQHRLQ
QAQLMRRRMATMNTRNVPQQSLPSPTSAPPGTPTQQPSTPQTPQPPAQPQPSPVSMSPAG
FPSVARTQPPTTVSTGKPTSQVPAPPPPAQPPPAAVEAARQIEREAQQQQHLYRVNINNS
MPPGRTGMGTPGSQMAPVSLNVPRPNQVSGPVMPSMPPGQWQQAPLPQQQPMPGLPRPVI
SMQAQAAVAGPRMPSVQPPRSISPSALQDLLRTLKSPSSPQQQQQVLNILKSNPQLMAAF
IKQRTAKYVANQPGMQPQPGLQSQPGMQPQPGMHQQPSLQNLNAMQAGVPRPGVPPQQQA
MGGLNPQGQALNIMNPGHNPNMASMNPQYREMLRRQLLQQQQQQQQQQQQQQQQQQGSAG
MAGGMAGHGQFQQPQGPGGYPPAMQQQQRMQQHLPLQGSSMGQMAAQMGQLGQMGQPGLG
ADSTPNIQQALQQRILQQQQMKQQIGSPGQPNPMSPQQHMLSGQPQASHLPGQQIATSLS
NQVRSPAPVQSPRPQSQPPHSSPSPRIQPQPSPHHVSPQTGSPHPGLAVTMASSIDQGHL
GNPEQSAMLPQLNTPSRSALSSELSLVGDTTGDTLEKFVEGL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0R4IPF2	0.378	0.392	0.000	2349	0.649	0.675	A0A0R4IPF2.pdb.gz	A0A0R4IPF2_DANRE histone acetyltransferase OS=Danio rerio OX=7955 GN=crebbpa PE=1 SV=1
2	AFDB:P34545	0.300	0.358	0.000	2017	0.315	0.382	P34545.pdb.gz	CBP1_CAEEL Protein cbp-1 OS=Caenorhabditis elegans OX=6239 GN=cbp-1 PE=1 SV=6
3	AFDB:Q6JHU9	0.495	0.495	0.000	2442	0.958	0.958	Q6JHU9.pdb.gz	CBP_RAT Histone lysine acetyltransferase CREBBP OS=Rattus norvegicus OX=10116 GN=Crebbp PE=1 SV=1
4	AFDB:X1WG57	0.383	0.360	0.000	2615	0.559	0.522	X1WG57.pdb.gz
5	AFDB:Q9LE42	0.211	0.292	1.691E-45	1670	0.150	0.220	Q9LE42.pdb.gz	HAC5_ARATH Histone acetyltransferase HAC5 OS=Arabidopsis thaliana OX=3702 GN=HAC5 PE=2 SV=1
6	AFDB:X2JEM2	0.039	0.041	1.626E-7	2326	0.126	0.132	X2JEM2.pdb.gz	X2JEM2_DROME Secretory 16, isoform I OS=Drosophila melanogaster OX=7227 GN=Sec16 PE=1 SV=1
7	AFDB:Q9HCM3	0.038	0.042	3.658E-6	1950	0.131	0.164	Q9HCM3.pdb.gz	K1549_HUMAN UPF0606 protein KIAA1549 OS=Homo sapiens OX=9606 GN=KIAA1549 PE=1 SV=4
8	AFDB:Q6FRV6	0.035	0.037	6.818E-6	2238	0.115	0.125	Q6FRV6.pdb.gz	SEC16_CANGA COPII coat assembly protein SEC16 OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=SEC16 PE=3 SV=1
9	AFDB:Q96L73	0.037	0.040	1.956E-5	2696	0.130	0.118	Q96L73.pdb.gz	NSD1_HUMAN Histone-lysine N-methyltransferase, H3 lysine-36 specific OS=Homo sapiens OX=9606 GN=NSD1 PE=1 SV=1
10	AFDB:Q68FD9	0.037	0.043	9.055E-5	1940	0.129	0.163	Q68FD9.pdb.gz	K1549_MOUSE UPF0606 protein KIAA1549 OS=Mus musculus OX=10090 GN=Kiaa1549 PE=1 SV=3
11	PDB:7tbhA	0.027	0.253	2.240E-4	243	0.027	0.276	7tbhA.pdb.gz	Cryo-EM, Protein Engineering, and Simulation Enable the Development of Peptide Therapeutics against Acute Myeloid Leukemia.
12	PDB:7c3oA	0.086	0.493	1.521E-3	316	0.018	0.142	7c3oA.pdb.gz	Crystal structure of TT109 from CANDIDA ALBICANS
13	PDB:2zfnA	0.086	0.432	6.401E-3	376	0.018	0.117	2zfnA.pdb.gz	Structural insights into histone h3 lysine 56 acetylation by rtt109
14	PDB:3q66C	0.090	0.390	2.567E-2	432	0.018	0.102	3q66C.pdb.gz
15	PDB:6k15H	0.027	0.117	4.145E-2	393	0.018	0.112	6k15H.pdb.gz	Structure of the RSC complex bound to the nucleosome.
16	PDB:1tiqA	0.028	0.306	1.511E-1	173	0.007	0.098	1tiqA.pdb.gz	Structural and functional evidence for Bacillus subtilis PaiA as a novel N1-spermidine/spermine acetyltransferase.
17	PDB:1s5kA	0.020	0.218	3.251E-1	153	0.006	0.092	1s5kA.pdb.gz	A bacterial acetyltransferase capable of regioselective N-acetylation of antibiotics and histones
18	PDB:6hd7v	0.030	0.363	5.002E-1	161	0.005	0.068	6hd7v.pdb.gz	Ribosome-NatA architecture reveals that rRNA expansion segments coordinate N-terminal acetylation.
19	PDB:7stxA	0.026	0.307	7.338E-1	158	0.004	0.063	7stxA.pdb.gz	Cryo-EM structure of human NatB in complex with CoA-Alpha-Synuclein
20	PDB:4kegA	0.029	0.092	8.472E-1	535	0.005	0.024	4kegA.pdb.gz	The Lipid Ligands of the SPLUNC1 Protein

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0R4IPF2	2668	2349	0.661	0.688	A0A0R4IPF2_DANRE histone acetyltransferase OS=Danio rerio OX=7955 GN=crebbpa PE=1 SV=1
2	A0A2R8Q4T2	1916	2267	0.444	0.478	A0A2R8Q4T2_DANRE histone acetyltransferase OS=Danio rerio OX=7955 GN=crebbpa PE=1 SV=1
3	A0A669KB12	2388	2388	0.599	0.613	A0A669KB12_HUMAN histone acetyltransferase OS=Homo sapiens OX=9606 GN=EP300 PE=1 SV=1
4	A0A8I6G641	2014	1945	0.497	0.624	A0A8I6G641_RAT histone acetyltransferase OS=Rattus norvegicus OX=10116 GN=Ep300 PE=1 SV=1
5	B2RWS6	1774	2412	0.413	0.418	EP300_MOUSE Histone acetyltransferase p300 OS=Mus musculus OX=10090 GN=Ep300 PE=1 SV=2
6	E1B8D6	1764	2411	0.415	0.421	E1B8D6_BOVIN histone acetyltransferase OS=Bos taurus OX=9913 GN=EP300 PE=4 SV=2
7	F1NGB5	3794	2420	0.870	0.878	F1NGB5_CHICK histone acetyltransferase OS=Gallus gallus OX=9031 GN=CREBBP PE=4 SV=4
8	F1RK46	4258	2440	0.951	0.952	F1RK46_PIG histone acetyltransferase OS=Sus scrofa OX=9823 GN=CREBBP PE=1 SV=3
9	I3L466	2271	1105	0.448	0.991	I3L466_HUMAN histone acetyltransferase (Fragment) OS=Homo sapiens OX=9606 GN=CREBBP PE=1 SV=2
10	M9MS40	1223	3282	0.230	0.171	M9MS40_DROME histone acetyltransferase OS=Drosophila melanogaster OX=7227 GN=nej PE=1 SV=1
11	M9PH39	1232	3266	0.230	0.172	M9PH39_DROME histone acetyltransferase OS=Drosophila melanogaster OX=7227 GN=nej PE=1 SV=1
12	O01368	1220	3190	0.230	0.176	O01368_DROME histone acetyltransferase OS=Drosophila melanogaster OX=7227 GN=nej PE=1 SV=1
13	O60424	1843	923	0.376	0.993	O60424_HUMAN histone acetyltransferase (Fragment) OS=Homo sapiens OX=9606 GN=CBP PE=4 SV=1
14	P34545	863	2017	0.178	0.216	CBP1_CAEEL Protein cbp-1 OS=Caenorhabditis elegans OX=6239 GN=cbp-1 PE=1 SV=6
15	P45481	4242	2441	0.954	0.954	CBP_MOUSE Histone lysine acetyltransferase CREBBP OS=Mus musculus OX=10090 GN=Crebbp PE=1 SV=3
16	Q09472	2394	2414	0.602	0.609	EP300_HUMAN Histone acetyltransferase p300 OS=Homo sapiens OX=9606 GN=EP300 PE=1 SV=2
17	Q6JHU9	4269	2442	0.958	0.958	CBP_RAT Histone lysine acetyltransferase CREBBP OS=Rattus norvegicus OX=10116 GN=Crebbp PE=1 SV=1
18	Q8BJ14	612	714	0.160	0.548	Q8BJ14_MOUSE histone acetyltransferase OS=Mus musculus OX=10090 GN=Ep300 PE=2 SV=1
19	Q92793	4998	2442	1.000	1.000	CBP_HUMAN CREB-binding protein OS=Homo sapiens OX=9606 GN=CREBBP PE=1 SV=3
20	Q9W321	1224	3276	0.230	0.172	Q9W321_DROME histone acetyltransferase OS=Drosophila melanogaster OX=7227 GN=nej PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00439 Bromodomain	4.7e-13	60.4	Bromodomain
2	PF09030 Creb_binding	1.5e-29	114.2	Creb binding
3	PF08214 HAT_KAT11	3.7e-65	232.1	Histone acetylation protein
4	PF02172 KIX	1.4e-35	132.7	KIX domain
5	PF16987 KIX_2	0.065	24.6	KIX domain
6	PF11707 Npa1	24	15.8	Ribosome 60S biogenesis N-terminal
7	PF06001 RING_CBP-p300	1.2e-19	81.6	CREB-binding protein/p300, atypical RING domain
8	PF02135 zf-TAZ	1.3e-26	104.2	TAZ zinc finger
9	PF00569 ZZ	9.6e-12	55.8	Zinc finger, ZZ type

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000262367

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000263754	0.999	Histone acetyltransferase KAT2B
2	9606.ENSP00000269305	0.999	Cellular tumor antigen p53
3	9606.ENSP00000287820	0.999	Peroxisome proliferator-activated receptor gamma
4	9606.ENSP00000332973	0.999	Mothers against decapentaplegic homolog 3
5	9606.ENSP00000339992	0.999	Transcriptional activator Myb
6	9606.ENSP00000344456	0.999	Catenin beta-1
7	9606.ENSP00000347184	0.999	Huntingtin
8	9606.ENSP00000354394	0.999	Signal transducer and activator of transcription 1-alpha/beta
9	9606.ENSP00000361066	0.999	Nuclear receptor coactivator 3
10	9606.ENSP00000384273	0.999	Transcription factor p65
11	9606.ENSP00000385216	0.999	Nuclear receptor coactivator 1
12	9606.ENSP00000387699	0.999	Cyclic AMP-responsive element-binding protein 1
13	9606.ENSP00000437955	0.999	Hypoxia-inducible factor 1-alpha
14	9606.ENSP00000444198	0.999	Cbp/p300-interacting transactivator 2
15	9606.ENSP00000471896	0.999	Interferon regulatory factor 3
16	9606.ENSP00000341208	0.998	Signal transducer and activator of transcription 5A
17	9606.ENSP00000360266	0.998	Transcription factor AP-1
18	9606.ENSP00000376077	0.998	Small ubiquitin-related modifier 1
19	9606.ENSP00000399968	0.998	Nuclear receptor coactivator 2
20	9606.ENSP00000405330	0.998	Estrogen receptor

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003713	1.000	transcription coactivator activity
GO:0140297	1.000	DNA-binding transcription factor binding
GO:0004402	1.000	histone acetyltransferase activity
GO:0001221	0.988	transcription coregulator binding
GO:0001223	0.976	transcription coactivator binding
GO:0005102	0.973	signaling receptor binding
GO:0046332	0.970	SMAD binding
GO:0003676	0.955	nucleic acid binding
GO:0003677	0.946	DNA binding
GO:0042975	0.926	peroxisome proliferator activated receptor binding
GO:0061629	0.715	RNA polymerase II-specific DNA-binding transcription factor binding
GO:1990837	0.568	sequence-specific double-stranded DNA binding
GO:0000976	0.463	transcription cis-regulatory region binding
GO:0003682	0.438	chromatin binding
GO:0000977	0.360	RNA polymerase II transcription regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.989	response to stimulus
GO:0010468	0.989	regulation of gene expression
GO:0051171	0.986	regulation of nitrogen compound metabolic process
GO:0031326	0.986	regulation of cellular biosynthetic process
GO:0080090	0.979	regulation of primary metabolic process
GO:2001141	0.970	regulation of RNA biosynthetic process
GO:0009987	0.968	cellular process
GO:0006355	0.964	regulation of DNA-templated transcription
GO:0048522	0.963	positive regulation of cellular process
GO:0009893	0.941	positive regulation of metabolic process
GO:0010604	0.900	positive regulation of macromolecule metabolic process
GO:0006357	0.880	regulation of transcription by RNA polymerase II
GO:0031325	0.877	positive regulation of cellular metabolic process
GO:0051173	0.875	positive regulation of nitrogen compound metabolic process
GO:0045935	0.817	positive regulation of nucleobase-containing compound metabolic process
GO:0008152	0.747	metabolic process
GO:0045893	0.747	positive regulation of DNA-templated transcription
GO:0045944	0.743	positive regulation of transcription by RNA polymerase II
GO:0071704	0.699	organic substance metabolic process
GO:0044238	0.644	primary metabolic process
GO:0006807	0.598	nitrogen compound metabolic process
GO:0043170	0.550	macromolecule metabolic process
GO:0006950	0.545	response to stress
GO:0032502	0.536	developmental process
GO:0048519	0.402	negative regulation of biological process
GO:1901564	0.400	organonitrogen compound metabolic process
GO:0048856	0.397	anatomical structure development
GO:0048523	0.359	negative regulation of cellular process
GO:0036211	0.359	protein modification process
GO:0032501	0.348	multicellular organismal process
GO:0051716	0.347	cellular response to stimulus
GO:0048583	0.310	regulation of response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0032991	0.975	protein-containing complex
GO:0005737	0.929	cytoplasm
GO:0043232	0.704	intracellular non-membrane-bounded organelle
GO:0005829	0.641	cytosol
GO:0016604	0.559	nuclear body
GO:0005694	0.540	chromosome
GO:0000785	0.464	chromatin
GO:0005667	0.461	transcription regulator complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:21992	1.000	acetyl-CoA + L-lysyl-[histone] = CoA + H(+) + N(6)-acetyl-L-lysyl-[histone]
EC:2.3.1.48	1.000	histone acetyltransferase.

[back to server]