StarFunc result for job id Q92794

User Input

>input (2004 residues)
MVKLANPLYTEWILEAIKKVKKQKQRPSEERICNAVSSSHGLDRKTVLEQLELSVKDGTI
LKVSNKGLNSYKDPDNPGRIALPKPRNHGKLDNKQNVDWNKLIKRAVEGLAESGGSTLKS
IERFLKGQKDVSALFGGSAASGFHQQLRLAIKRAIGHGRLLKDGPLYRLNTKATNVDGKE
SCESLSCLPPVSLLPHEKDKPVAEPIPICSFCLGTKEQNREKKPEELISCADCGNSGHPS
CLKFSPELTVRVKALRWQCIECKTCSSCRDQGKNADNMLFCDSCDRGFHMECCDPPLTRM
PKGMWICQICRPRKKGRKLLQKKAAQIKRRYTNPIGRPKNRLKKQNTVSKGPFSKVRTGP
GRGRKRKITLSSQSASSSSEEGYLERIDGLDFCRDSNVSLKFNKKTKGLIDGLTKFFTPS
PDGRKARGEVVDYSEQYRIRKRGNRKSSTSDWPTDNQDGWDGKQENEERLFGSQEIMTEK
DMELFRDIQEQALQKVGVTGPPDPQVRCPSVIEFGKYEIHTWYSSPYPQEYSRLPKLYLC
EFCLKYMKSRTILQQHMKKCGWFHPPANEIYRKNNISVFEVDGNVSTIYCQNLCLLAKLF
LDHKTLYYDVEPFLFYVLTQNDVKGCHLVGYFSKEKHCQQKYNVSCIMILPQYQRKGYGR
FLIDFSYLLSKREGQAGSPEKPLSDLGRLSYMAYWKSVILECLYHQNDKQISIKKLSKLT
GICPQDITSTLHHLRMLDFRSDQFVIIRREKLIQDHMAKLQLNLRPVDVDPECLRWTPVI
VSNSVVSEEEEEEAEEGENEEPQCQERELEISVGKSVSHENKEQDSYSVESEKKPEVMAP
VSSTRLSKQVLPHDSLPANSQPSRRGRWGRKNRKTQERFGDKDSKLLLEETSSAPQEQYG
ECGEKSEATQEQYTESEEQLVASEEQPSQDGKPDLPKRRLSEGVEPWRGQLKKSPEALKC
RLTEGSERLPRRYSEGDRAVLRGFSESSEEEEEPESPRSSSPPILTKPTLKRKKPFLHRR
RRVRKRKHHNSSVVTETISETTEVLDEPFEDSDSERPMPRLEPTFEIDEEEEEEDENELF
PREYFRRLSSQDVLRCQSSSKRKSKDEEEDEESDDADDTPILKPVSLLRKRDVKNSPLEP
DTSTPLKKKKGWPKGKSRKPIHWKKRPGRKPGFKLSREIMPVSTQACVIEPIVSIPKAGR
KPKIQESEETVEPKEDMPLPEERKEEEEMQAEAEEAEEGEEEDAASSEVPAASPADSSNS
PETETKEPEVEEEEEKPRVSEEQRQSEEEQQELEEPEPEEEEDAAAETAQNDDHDADDED
DGHLESTKKKELEEQPTREDVKEEPGVQESFLDANMQKSREKIKDKEETELDSEEEQPSH
DTSVVSEQMAGSEDDHEEDSHTKEELIELKEEEEIPHSELDLETVQAVQSLTQEESSEHE
GAYQDCEETLAACQTLQSYTQADEDPQMSMVEDCHASEHNSPISSVQSHPSQSVRSVSSP
NVPALESGYTQISPEQGSLSAPSMQNMETSPMMDVPSVSDHSQQVVDSGFSDLGSIESTT
ENYENPSSYDSTMGGSICGNSSSQSSCSYGGLSSSSSLTQSSCVVTQQMASMGSSCSMMQ
QSSVQPAANCSIKSPQSCVVERPPSNQQQQPPPPPPQQPQPPPPQPQPAPQPPPPQQQPQ
QQPQPQPQQPPPPPPPQQQPPLSQCSMNNSFTPAPMIMEIPESGSTGNISIYERIPGDFG
AGSYSQPSATFSLAKLQQLTNTIMDPHAMPYSHSPAVTSYATSVSLSNTGLAQLAPSHPL
AGTPQAQATMTPPPNLASTTMNLTSPLLQCNMSATNIGIPHTQRLQGQMPVKGHISIRSK
SAPLPSAAAHQQQLYGRSPSAVAMQAGPRALAVQRGMNMGVNLMPTPAYNVNSMNMNTLN
AMNSYRMTQPMMNSSYHSNPAYMNQTAQYPMQMQMGMMGSQAYTQQPMQPNPHGNMMYTG
PSHHSYMNAAGVPKQSLNGPYMRR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A2CG09	0.276	0.252	0.000	2246	0.601	0.536	A2CG09.pdb.gz	A2CG09_DANRE Histone acetyltransferase OS=Danio rerio OX=7955 GN=myst3 PE=1 SV=1
2	AFDB:Q8BRB7	0.280	0.296	0.000	1872	0.535	0.573	Q8BRB7.pdb.gz	KAT6B_MOUSE Histone acetyltransferase KAT6B OS=Mus musculus OX=10090 GN=Kat6b PE=1 SV=3
3	AFDB:Q8BZ21	0.375	0.375	0.000	2003	0.891	0.891	Q8BZ21.pdb.gz	KAT6A_MOUSE Histone acetyltransferase KAT6A OS=Mus musculus OX=10090 GN=Kat6a PE=1 SV=2
4	AFDB:Q8WYB5	0.225	0.218	0.000	2073	0.549	0.531	Q8WYB5.pdb.gz	KAT6B_HUMAN Histone acetyltransferase KAT6B OS=Homo sapiens OX=9606 GN=KAT6B PE=1 SV=3
5	AFDB:Q92794	0.999	0.999	0.000	2004	1.000	1.000	Q92794.pdb.gz	KAT6A_HUMAN Histone acetyltransferase KAT6A OS=Homo sapiens OX=9606 GN=KAT6A PE=1 SV=2
6	AFDB:Q9W1A9	0.161	0.143	1.083E-67	2291	0.251	0.220	Q9W1A9.pdb.gz	Q9W1A9_DROME histone acetyltransferase OS=Drosophila melanogaster OX=7227 GN=enok PE=1 SV=2
7	AFDB:E7EUP3	0.147	0.669	6.476E-40	425	0.087	0.412	E7EUP3.pdb.gz	E7EUP3_HUMAN histone acetyltransferase OS=Homo sapiens OX=9606 GN=KAT7 PE=1 SV=1
8	AFDB:B0R0X6	0.136	0.515	3.221E-38	520	0.083	0.319	B0R0X6.pdb.gz	B0R0X6_DANRE Histone acetyltransferase OS=Danio rerio OX=7955 GN=zgc:92510 PE=1 SV=1
9	AFDB:C8VBH4	0.138	0.526	2.271E-37	508	0.074	0.293	C8VBH4.pdb.gz	ESA1_EMENI Histone acetyltransferase esa1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=esa1 PE=3 SV=1
10	AFDB:A0A024R597	0.136	0.522	5.547E-37	513	0.088	0.343	A0A024R597.pdb.gz
11	PDB:7cmrA	0.130	0.968	9.719E-37	263	0.075	0.574	7cmrA.pdb.gz	The Crystal Structure of human MYST1 from Biortus.
12	PDB:7vvuP	0.132	0.943	3.132E-32	270	0.067	0.496	7vvuP.pdb.gz	Structure of the NuA4 acetyltransferase complex bound to the nucleosome.
13	PDB:5lzbz	0.042	0.105	2.183E-3	614	0.015	0.049	5lzbz.pdb.gz	The pathway to GTPase activation of elongation factor SelB on the ribosome.
14	PDB:3cuqA	0.031	0.221	7.049E-3	219	0.015	0.137	3cuqA.pdb.gz
15	PDB:2xv4S	0.043	0.154	2.035E-2	399	0.010	0.050	2xv4S.pdb.gz
16	PDB:6dk4A	0.032	0.391	3.008E-2	135	0.004	0.067	6dk4A.pdb.gz	Crystal structure of Campylobacter jejuni peroxide regulator.
17	PDB:6yugA	0.050	0.521	3.008E-2	143	0.012	0.168	6yugA.pdb.gz	Plasmodium falciparum Apicomplexan-Specific Glucosamine-6-Phosphate N -Acetyltransferase Is Key for Amino Sugar Metabolism and Asexual Blood Stage Development.
18	PDB:7k5yU	0.032	0.691	3.557E-2	75	0.008	0.213	7k5yU.pdb.gz	Distinct Structures and Dynamics of Chromatosomes with Different Human Linker Histone Isoforms.
19	PDB:2beiB	0.053	0.493	5.257E-2	159	0.013	0.170	2beiB.pdb.gz	Crystal structure of Homo sapiens thialysine Nepsilon-acetyltransferase (HsSSAT2) in complex with acetyl coenzyme A.
20	PDB:5jq4B	0.051	0.527	5.558E-2	146	0.009	0.123	5jq4B.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A3B3IS53	0.0	3444	1677	0.837	1.000	A0A3B3IS53_HUMAN Histone acetyltransferase (Fragment) OS=Homo sapiens OX=9606 GN=KAT6A PE=1 SV=1
2	A0A3B3ITI3	0.0	3097	1565	0.754	0.965	A0A3B3ITI3_HUMAN Histone acetyltransferase (Fragment) OS=Homo sapiens OX=9606 GN=KAT6A PE=1 SV=1
3	A0A3F2YNX6	0.0	4135	2006	1.000	0.999	A0A3F2YNX6_HUMAN Histone acetyltransferase OS=Homo sapiens OX=9606 GN=KAT6A PE=1 SV=1
4	A0A8I6GLZ3	0.0	616	2039	0.153	0.150	A0A8I6GLZ3_RAT histone acetyltransferase OS=Rattus norvegicus OX=10116 GN=Kat6b PE=3 SV=1
5	A2CG09	0.0	1240	2246	0.300	0.268	A2CG09_DANRE Histone acetyltransferase OS=Danio rerio OX=7955 GN=myst3 PE=1 SV=1
6	M0R4T9	0.0	1129	1857	0.277	0.299	M0R4T9_RAT histone acetyltransferase OS=Rattus norvegicus OX=10116 GN=Kat6b PE=3 SV=3
7	Q5TKR9	0.0	2591	1998	0.717	0.719	KAT6A_RAT Histone acetyltransferase KAT6A OS=Rattus norvegicus OX=10116 GN=Kat6a PE=1 SV=2
8	Q8BRB7	0.0	1130	1872	0.270	0.289	KAT6B_MOUSE Histone acetyltransferase KAT6B OS=Mus musculus OX=10090 GN=Kat6b PE=1 SV=3
9	Q8BZ21	0.0	2637	2003	0.717	0.717	KAT6A_MOUSE Histone acetyltransferase KAT6A OS=Mus musculus OX=10090 GN=Kat6a PE=1 SV=2
10	Q8WYB5	0.0	618	2073	0.151	0.146	KAT6B_HUMAN Histone acetyltransferase KAT6B OS=Homo sapiens OX=9606 GN=KAT6B PE=1 SV=3
11	Q92794	0.0	4137	2004	1.000	1.000	KAT6A_HUMAN Histone acetyltransferase KAT6A OS=Homo sapiens OX=9606 GN=KAT6A PE=1 SV=2
12	O95251	1.36e-115	383	611	0.087	0.286	KAT7_HUMAN Histone acetyltransferase KAT7 OS=Homo sapiens OX=9606 GN=KAT7 PE=1 SV=1
13	Q5SVQ0	1.84e-115	382	613	0.087	0.285	KAT7_MOUSE Histone acetyltransferase KAT7 OS=Mus musculus OX=10090 GN=Kat7 PE=1 SV=1
14	Q7ZW29	3.12e-115	380	568	0.087	0.308	Q7ZW29_DANRE histone acetyltransferase OS=Danio rerio OX=7955 GN=myst2 PE=1 SV=1
15	E7EUP3	1.23e-114	373	425	0.087	0.412	E7EUP3_HUMAN histone acetyltransferase OS=Homo sapiens OX=9606 GN=KAT7 PE=1 SV=1
16	Q9W1A9	9.06e-111	397	2291	0.089	0.078	Q9W1A9_DROME histone acetyltransferase OS=Drosophila melanogaster OX=7227 GN=enok PE=1 SV=2
17	Q9VM15	6.98e-99	341	811	0.076	0.189	Q9VM15_DROME histone acetyltransferase OS=Drosophila melanogaster OX=7227 GN=chm PE=3 SV=2
18	Q9NHW0	8.84e-99	340	811	0.076	0.189	Q9NHW0_DROME histone acetyltransferase OS=Drosophila melanogaster OX=7227 GN=chm PE=2 SV=1
19	Q7SXF3	1.67e-97	326	487	0.075	0.308	Q7SXF3_DANRE Histone acetyltransferase OS=Danio rerio OX=7955 GN=myst1 PE=1 SV=1
20	Q9H7Z6	4.90e-97	323	458	0.076	0.332	KAT8_HUMAN Histone acetyltransferase KAT8 OS=Homo sapiens OX=9606 GN=KAT8 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00583 Acetyltransf_1	6.7e+02	11.9	Acetyltransferase (GNAT) family
2	PF13508 Acetyltransf_7	0.69	21.6	Acetyltransferase (GNAT) domain
3	PF08280 HTH_Mga	3e+02	12.9	M protein trans-acting positive regulator (MGA) HTH domain
4	PF00538 Linker_histone	0.039	25.6	linker histone H1 and H5 family
5	PF01853 MOZ_SAS	3.7e-79	276.1	MOZ/SAS family
6	PF00628 PHD	1.1e-15	68.6	PHD-finger
7	PF13831 PHD_2	11	16.8	PHD-finger
8	PF16866 PHD_4	6e+02	11.9	PHD-finger
9	PF17772 zf-MYST	2.3e-19	80.1	MYST family zinc finger domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000380136

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000216267	0.999	Bromodomain-containing protein 1
2	9606.ENSP00000322142	0.999	Inhibitor of growth protein 5
3	9606.ENSP00000373340	0.999	Peregrin
4	9606.ENSP00000362166	0.995	Chromatin modification-related protein MEAF6
5	9606.ENSP00000263253	0.981	Histone acetyltransferase p300
6	9606.ENSP00000399968	0.980	Nuclear receptor coactivator 2
7	9606.ENSP00000476960	0.978	Histone cluster 2 H3 pseudogene 2
8	9606.ENSP00000350267	0.977	Bromodomain and PHD finger-containing protein 3
9	9606.ENSP00000362649	0.972	Histone deacetylase 1
10	9606.ENSP00000430432	0.969	Histone deacetylase 2
11	9606.ENSP00000269305	0.961	Cellular tumor antigen p53
12	9606.ENSP00000480826	0.952	Histone cluster 1 H3 family member a
13	9606.ENSP00000355657	0.948	Histone H3.1t
14	9606.ENSP00000451828	0.937	RAC-alpha serine/threonine-protein kinase
15	9606.ENSP00000412302	0.933	Methyl-CpG-binding domain protein 3
16	9606.ENSP00000287239	0.923	Histone acetyltransferase KAT6B
17	9606.ENSP00000349508	0.923	Chromodomain-helicase-DNA-binding protein 4
18	9606.ENSP00000369424	0.923	Histone-binding protein RBBP7
19	9606.ENSP00000369716	0.922	Chromodomain-helicase-DNA-binding protein 3
20	9606.ENSP00000362592	0.921	Histone-binding protein RBBP4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0010484	1.000	histone H3 acetyltransferase activity
GO:0003677	0.988	DNA binding
GO:0003712	0.979	transcription coregulator activity
GO:0008134	0.977	transcription factor binding
GO:0003713	0.960	transcription coactivator activity
GO:0140297	0.946	DNA-binding transcription factor binding
GO:0010485	0.926	histone H4 acetyltransferase activity
GO:0043167	0.813	ion binding
GO:0003682	0.807	chromatin binding
GO:0008270	0.785	zinc ion binding
GO:0043997	0.625	histone H4K12 acetyltransferase activity
GO:0043995	0.623	histone H4K5 acetyltransferase activity
GO:0043996	0.619	histone H4K8 acetyltransferase activity
GO:0036408	0.589	histone H3K14 acetyltransferase activity
GO:0046972	0.350	histone H4K16 acetyltransferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0010468	0.997	regulation of gene expression
GO:0048518	0.987	positive regulation of biological process
GO:0009987	0.986	cellular process
GO:1903506	0.985	regulation of nucleic acid-templated transcription
GO:0006355	0.982	regulation of DNA-templated transcription
GO:0010604	0.975	positive regulation of macromolecule metabolic process
GO:0071704	0.907	organic substance metabolic process
GO:0044238	0.904	primary metabolic process
GO:0031325	0.894	positive regulation of cellular metabolic process
GO:0006807	0.886	nitrogen compound metabolic process
GO:0051173	0.881	positive regulation of nitrogen compound metabolic process
GO:0043170	0.869	macromolecule metabolic process
GO:0045935	0.850	positive regulation of nucleobase-containing compound metabolic process
GO:0010557	0.835	positive regulation of macromolecule biosynthetic process
GO:0031328	0.835	positive regulation of cellular biosynthetic process
GO:0045893	0.829	positive regulation of DNA-templated transcription
GO:1901564	0.823	organonitrogen compound metabolic process
GO:0043412	0.815	macromolecule modification
GO:0019538	0.814	protein metabolic process
GO:0036211	0.792	protein modification process
GO:0032502	0.769	developmental process
GO:0071840	0.767	cellular component organization or biogenesis
GO:0048519	0.749	negative regulation of biological process
GO:0016043	0.746	cellular component organization
GO:0050896	0.711	response to stimulus
GO:0048523	0.711	negative regulation of cellular process
GO:0044237	0.663	cellular metabolic process
GO:0010605	0.651	negative regulation of macromolecule metabolic process
GO:0031324	0.647	negative regulation of cellular metabolic process
GO:0051172	0.607	negative regulation of nitrogen compound metabolic process
GO:0048583	0.578	regulation of response to stimulus
GO:0048856	0.575	anatomical structure development
GO:0051716	0.539	cellular response to stimulus
GO:0045934	0.532	negative regulation of nucleobase-containing compound metabolic process
GO:0048869	0.488	cellular developmental process
GO:0018193	0.466	peptidyl-amino acid modification
GO:0006325	0.448	chromatin organization
GO:0016570	0.428	histone modification
GO:0045892	0.425	negative regulation of DNA-templated transcription
GO:0006357	0.406	regulation of transcription by RNA polymerase II
GO:0043543	0.377	protein acylation
GO:0030154	0.362	cell differentiation
GO:0006473	0.353	protein acetylation
GO:0006950	0.337	response to stress

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043232	0.999	intracellular non-membrane-bounded organelle
GO:0005654	0.999	nucleoplasm
GO:0005737	0.997	cytoplasm
GO:0005829	0.993	cytosol
GO:0032991	0.966	protein-containing complex
GO:0005694	0.947	chromosome
GO:0005730	0.755	nucleolus
GO:0000785	0.745	chromatin
GO:0016604	0.726	nuclear body
GO:0016607	0.449	nuclear speck
GO:1902494	0.436	catalytic complex
GO:1990234	0.431	transferase complex
GO:0140535	0.411	intracellular protein-containing complex
GO:0070775	0.400	H3 histone acetyltransferase complex
GO:0070776	0.384	MOZ/MORF histone acetyltransferase complex
GO:0016605	0.346	PML body

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:21992	1.000	acetyl-CoA + L-lysyl-[histone] = CoA + H(+) + N(6)-acetyl-L-lysyl-[histone]
EC:2.3.1.48	1.000	histone acetyltransferase.

[back to server]