StarFunc result for job id Q92800

User Input

>input (747 residues)
MEIPNPPTSKCITYWKRKVKSEYMRLRQLKRLQANMGAKALYVANFAKVQEKTQILNEEW
KKLRVQPVQSMKPVSGHPFLKKCTIESIFPGFASQHMLMRSLNTVALVPIMYSWSPLQQN
FMVEDETVLCNIPYMGDEVKEEDETFIEELINNYDGKVHGEEEMIPGSVLISDAVFLELV
DALNQYSDEEEEGHNDTSDGKQDDSKEDLPVTRKRKRHAIEGNKKSSKKQFPNDMIFSAI
ASMFPENGVPDDMKERYRELTEMSDPNALPPQCTPNIDGPNAKSVQREQSLHSFHTLFCR
RCFKYDCFLHPFHATPNVYKRKNKEIKIEPEPCGTDCFLLLEGAKEYAMLHNPRSKCSGR
RRRRHHIVSASCSNASASAVAETKEGDSDRDTGNDWASSSSEANSRCQTPTKQKASPAPP
QLCVVEAPSEPVEWTGAEESLFRVFHGTYFNNFCSIARLLGTKTCKQVFQFAVKESLILK
LPTDELMNPSQKKKRKHRLWAAHCRKIQLKKDNSSTQVYNYQPCDHPDRPCDSTCPCIMT
QNFCEKFCQCNPDCQNRFPGCRCKTQCNTKQCPCYLAVRECDPDLCLTCGASEHWDCKVV
SCKNCSIQRGLKKHLLLAPSDVAGWGTFIKESVQKNEFISEYCGELISQDEADRRGKVYD
KYMSSFLFNLNNDFVVDATRKGNKIRFANHSVNPNCYAKVVMVNGDHRIGIFAKRAIQAG
EELFFDYRYSQADALKYVGIERETDVL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:F1LZH3	0.922	0.922	0.000	747	0.977	0.977	F1LZH3.pdb.gz	F1LZH3_RAT [histone H3]-lysine(27) N-trimethyltransferase OS=Rattus norvegicus OX=10116 GN=Ezh1 PE=4 SV=3
2	AFDB:Q08BS4	0.787	0.774	5.488E-98	760	0.652	0.641	Q08BS4.pdb.gz	EZH2_DANRE Histone-lysine N-methyltransferase EZH2 OS=Danio rerio OX=7955 GN=ezh2 PE=2 SV=1
3	AFDB:A0A090N8E9	0.774	0.770	4.478E-93	751	0.649	0.646	A0A090N8E9.pdb.gz	A0A090N8E9_HUMAN Histone-lysine N-methyltransferase EZH2 OS=Homo sapiens OX=9606 GN=EZH2 PE=4 SV=1
4	AFDB:S4S3R8	0.719	0.757	4.294E-89	707	0.621	0.656	S4S3R8.pdb.gz	S4S3R8_HUMAN Histone-lysine N-methyltransferase EZH2 OS=Homo sapiens OX=9606 GN=EZH2 PE=4 SV=1
5	AFDB:P42124	0.795	0.782	3.031E-78	760	0.531	0.522	P42124.pdb.gz	EZ_DROME Histone-lysine N-methyltransferase E(z) OS=Drosophila melanogaster OX=7227 GN=E(z) PE=1 SV=2
6	PDB:5hynA	0.682	0.862	2.434E-75	581	0.558	0.718	5hynA.pdb.gz	Structural basis of oncogenic histone H3K27M inhibition of human polycomb repressive complex 2.
7	PDB:7td5A	0.648	0.968	3.395E-74	497	0.659	0.990	7td5A.pdb.gz	CK2-mediated phosphorylation of SUZ12 promotes PRC2 function by stabilizing enzyme active site.
8	PDB:6wkrC	0.734	0.895	1.424E-71	606	0.594	0.733	6wkrC.pdb.gz	JARID2 and AEBP2 regulate PRC2 in the presence of H2AK119ub1 and other histone modifications.
9	PDB:7td5F	0.587	0.975	2.006E-67	447	0.596	0.996	7td5F.pdb.gz	CK2-mediated phosphorylation of SUZ12 promotes PRC2 function by stabilizing enzyme active site.
10	PDB:7ksoA	0.515	0.961	1.595E-53	395	0.525	0.992	7ksoA.pdb.gz	Structures of monomeric and dimeric PRC2:EZH1 reveal flexible modules involved in chromatin compaction.
11	PDB:5wg6A	0.510	0.734	3.123E-49	517	0.412	0.596	5wg6A.pdb.gz	An Evolutionarily Conserved Structural Platform for PRC2 Inhibition by a Class of Ezh2 Inhibitors.
12	AFDB:K7EIH5	0.312	0.725	1.357E-38	296	0.395	0.997	K7EIH5.pdb.gz	K7EIH5_HUMAN Enhancer of zeste 1 polycomb repressive complex 2 subunit (Fragment) OS=Homo sapiens OX=9606 GN=EZH1 PE=1 SV=1
13	AFDB:O65312	0.545	0.585	1.297E-35	689	0.258	0.280	O65312.pdb.gz	MEDEA_ARATH Histone-lysine N-methyltransferase MEDEA OS=Arabidopsis thaliana OX=3702 GN=MEA PE=1 SV=1
14	AFDB:O17514	0.543	0.527	1.724E-32	773	0.222	0.215	O17514.pdb.gz	MES2_CAEEL Histone-lysine N-methyltransferase mes-2 OS=Caenorhabditis elegans OX=6239 GN=mes-2 PE=1 SV=2
15	AFDB:Q9Y7R4	0.167	0.136	2.557E-12	920	0.159	0.129	Q9Y7R4.pdb.gz	SET1_SCHPO Histone-lysine N-methyltransferase, H3 lysine-4 specific OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=set1 PE=1 SV=1
16	AFDB:Q9UPS6	0.163	0.065	4.941E-12	1966	0.157	0.060	Q9UPS6.pdb.gz	SET1B_HUMAN Histone-lysine N-methyltransferase SETD1B OS=Homo sapiens OX=9606 GN=SETD1B PE=1 SV=3
17	PDB:1pegA	0.190	0.480	3.969E-9	266	0.072	0.203	1pegA.pdb.gz	Structural basis for the product specificity of histone lysine methyltransferases
18	PDB:5h6zA	0.128	0.656	1.765E-5	123	0.031	0.187	5h6zA.pdb.gz
19	PDB:6c24C	0.174	0.751	2.453E-5	148	0.108	0.547	6c24C.pdb.gz	Structures of human PRC2 with its cofactors AEBP2 and JARID2.
20	PDB:2g46A	0.121	0.628	5.905E-5	119	0.036	0.227	2g46A.pdb.gz	Structural insights of the specificity and catalysis of a viral histone H3 lysine 27 methyltransferase.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A090N8E9	0.0	961	751	0.648	0.644	A0A090N8E9_HUMAN Histone-lysine N-methyltransferase EZH2 OS=Homo sapiens OX=9606 GN=EZH2 PE=4 SV=1
2	A0A0A0MSY9	0.0	1541	738	0.988	1.000	A0A0A0MSY9_HUMAN [histone H3]-lysine(27) N-trimethyltransferase OS=Homo sapiens OX=9606 GN=EZH1 PE=1 SV=1
3	A0A8I5ZPT6	0.0	929	734	0.636	0.647	A0A8I5ZPT6_RAT Histone-lysine N-methyltransferase EZH2 OS=Rattus norvegicus OX=10116 GN=Ezh2 PE=4 SV=1
4	A0A8I6A7B9	0.0	1379	681	0.878	0.963	A0A8I6A7B9_RAT [histone H3]-lysine(27) N-trimethyltransferase OS=Rattus norvegicus OX=10116 GN=Ezh1 PE=4 SV=1
5	A0A8I6AHI4	0.0	908	676	0.614	0.679	A0A8I6AHI4_RAT [histone H3]-lysine(27) N-trimethyltransferase OS=Rattus norvegicus OX=10116 GN=Ezh2 PE=4 SV=1
6	A0A8I6GAA5	0.0	909	707	0.624	0.659	A0A8I6GAA5_RAT Histone-lysine N-methyltransferase EZH2 OS=Rattus norvegicus OX=10116 GN=Ezh2 PE=4 SV=1
7	A0A8I6GJI6	0.0	877	704	0.610	0.648	A0A8I6GJI6_RAT Histone-lysine N-methyltransferase EZH2 OS=Rattus norvegicus OX=10116 GN=Ezh2 PE=4 SV=1
8	B5DFE2	0.0	972	746	0.652	0.653	B5DFE2_RAT Histone-lysine N-methyltransferase EZH2 OS=Rattus norvegicus OX=10116 GN=Ezh2 PE=1 SV=1
9	F1LZH3	0.0	1535	750	0.977	0.973	F1LZH3_RAT [histone H3]-lysine(27) N-trimethyltransferase OS=Rattus norvegicus OX=10116 GN=Ezh1 PE=4 SV=3
10	K7EIH5	0.0	596	296	0.396	1.000	K7EIH5_HUMAN Enhancer of zeste 1 polycomb repressive complex 2 subunit (Fragment) OS=Homo sapiens OX=9606 GN=EZH1 PE=1 SV=1
11	P42124	0.0	711	760	0.522	0.513	EZ_DROME Histone-lysine N-methyltransferase E(z) OS=Drosophila melanogaster OX=7227 GN=E(z) PE=1 SV=2
12	P70351	0.0	1535	747	0.979	0.979	EZH1_MOUSE Histone-lysine N-methyltransferase EZH1 OS=Mus musculus OX=10090 GN=Ezh1 PE=1 SV=1
13	Q08BS4	0.0	988	760	0.661	0.650	EZH2_DANRE Histone-lysine N-methyltransferase EZH2 OS=Danio rerio OX=7955 GN=ezh2 PE=2 SV=1
14	Q15910	0.0	971	746	0.649	0.650	EZH2_HUMAN Histone-lysine N-methyltransferase EZH2 OS=Homo sapiens OX=9606 GN=EZH2 PE=1 SV=2
15	Q61188	0.0	972	746	0.652	0.653	EZH2_MOUSE Histone-lysine N-methyltransferase EZH2 OS=Mus musculus OX=10090 GN=Ezh2 PE=1 SV=2
16	Q6AXH7	0.0	953	742	0.648	0.652	Q6AXH7_MOUSE Histone-lysine N-methyltransferase EZH2 OS=Mus musculus OX=10090 GN=Ezh2 PE=1 SV=1
17	Q92800	0.0	1568	747	1.000	1.000	EZH1_HUMAN Histone-lysine N-methyltransferase EZH1 OS=Homo sapiens OX=9606 GN=EZH1 PE=1 SV=2
18	S4S3R8	0.0	909	707	0.621	0.656	S4S3R8_HUMAN Histone-lysine N-methyltransferase EZH2 OS=Homo sapiens OX=9606 GN=EZH2 PE=4 SV=1
19	P93831	1.71e-71	253	902	0.191	0.159	CLF_ARATH Histone-lysine N-methyltransferase CLF OS=Arabidopsis thaliana OX=3702 GN=CLF PE=1 SV=2
20	O65312	1.49e-70	246	689	0.185	0.200	MEDEA_ARATH Histone-lysine N-methyltransferase MEDEA OS=Arabidopsis thaliana OX=3702 GN=MEA PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11616 EZH2_WD-Binding	2e-14	64.6	WD repeat binding protein EZH2
2	PF00249 Myb_DNA-binding	3.7e+02	12.7	Myb-like DNA-binding domain
3	PF18118 PRC2_HTH_1	2.2e-23	94.3	Polycomb repressive complex 2 tri-helical domain
4	PF18264 preSET_CXC	2e-06	39.4	CXC domain
5	PF00856 SET	3.9e-14	64.9	SET domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000404658

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000263360	0.999	Polycomb protein EED
2	9606.ENSP00000316578	0.999	Polycomb protein SUZ12
3	9606.ENSP00000362592	0.994	Histone-binding protein RBBP4
4	9606.ENSP00000369424	0.994	Histone-binding protein RBBP7
5	9606.ENSP00000381840	0.986	Zinc finger protein AEBP2
6	9606.ENSP00000359321	0.979	Metal-response element-binding transcription factor 2
7	9606.ENSP00000363787	0.975	E3 ubiquitin-protein ligase RING1
8	9606.ENSP00000483946	0.973	PHD finger protein 19
9	9606.ENSP00000356480	0.971	E3 ubiquitin-protein ligase RING2
10	9606.ENSP00000430432	0.971	Histone deacetylase 2
11	9606.ENSP00000269385	0.970	Chromobox protein homolog 8
12	9606.ENSP00000341280	0.970	Protein Jumonji
13	9606.ENSP00000384490	0.968	Chromobox protein homolog 6
14	9606.ENSP00000365851	0.965	Polycomb complex protein BMI-1
15	9606.ENSP00000473391	0.965	annotation not available
16	9606.ENSP00000216133	0.963	Chromobox protein homolog 7
17	9606.ENSP00000308750	0.961	Chromobox protein homolog 2
18	9606.ENSP00000269397	0.960	E3 SUMO-protein ligase CBX4
19	9606.ENSP00000233630	0.952	Polycomb group RING finger protein 1
20	9606.ENSP00000320147	0.952	Histone-lysine N-methyltransferase EZH2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003682	1.000	chromatin binding
GO:0005515	0.999	protein binding
GO:0003824	0.986	catalytic activity
GO:0003676	0.982	nucleic acid binding
GO:0140096	0.980	catalytic activity, acting on a protein
GO:0008276	0.966	protein methyltransferase activity
GO:0018024	0.956	histone lysine N-methyltransferase activity
GO:0140938	0.948	histone H3 methyltransferase activity
GO:0003677	0.944	DNA binding
GO:0043565	0.789	sequence-specific DNA binding
GO:0140110	0.584	transcription regulator activity
GO:0003690	0.544	double-stranded DNA binding
GO:1990837	0.526	sequence-specific double-stranded DNA binding
GO:0046976	0.467	histone H3K27 methyltransferase activity
GO:0000976	0.416	transcription cis-regulatory region binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0006355	0.986	regulation of DNA-templated transcription
GO:0032502	0.965	developmental process
GO:0009987	0.960	cellular process
GO:0048856	0.939	anatomical structure development
GO:0006357	0.933	regulation of transcription by RNA polymerase II
GO:0048518	0.923	positive regulation of biological process
GO:0048522	0.913	positive regulation of cellular process
GO:0032501	0.885	multicellular organismal process
GO:0048519	0.849	negative regulation of biological process
GO:0007275	0.827	multicellular organism development
GO:0071704	0.809	organic substance metabolic process
GO:0009893	0.788	positive regulation of metabolic process
GO:0044238	0.786	primary metabolic process
GO:0006807	0.785	nitrogen compound metabolic process
GO:0010604	0.780	positive regulation of macromolecule metabolic process
GO:0048523	0.769	negative regulation of cellular process
GO:0043170	0.727	macromolecule metabolic process
GO:1902679	0.715	negative regulation of RNA biosynthetic process
GO:0045892	0.714	negative regulation of DNA-templated transcription
GO:0043412	0.696	macromolecule modification
GO:0048513	0.643	animal organ development
GO:0021766	0.604	hippocampus development
GO:0051173	0.595	positive regulation of nitrogen compound metabolic process
GO:0071840	0.516	cellular component organization or biogenesis
GO:0000122	0.515	negative regulation of transcription by RNA polymerase II
GO:0031325	0.510	positive regulation of cellular metabolic process
GO:0036211	0.486	protein modification process
GO:0016043	0.464	cellular component organization
GO:0016570	0.437	histone modification
GO:0006338	0.410	chromatin remodeling
GO:0044237	0.378	cellular metabolic process
GO:0010629	0.369	negative regulation of gene expression
GO:0045935	0.324	positive regulation of nucleobase-containing compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.998	nucleoplasm
GO:0032991	0.923	protein-containing complex
GO:0140513	0.802	nuclear protein-containing complex
GO:1990234	0.749	transferase complex
GO:0031519	0.721	PcG protein complex
GO:0005737	0.324	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.1.1.-	0.972	Methyltransferases.
RHEA:51736	0.958	L-lysyl-[protein] + S-adenosyl-L-methionine = H(+) + N(6)-methyl-L-lysyl-[protein] + S-adenosyl-L-homocysteine
EC:2.1.1.356	0.467	[histone H3]-lysine(27) N-trimethyltransferase.

[back to server]