StarFunc result for job id Q92802

User Input

>input (583 residues)
MSYGEIEGKFLGPREEVTSEPRCKKLKSTTESYVFHNHSNADFHRIQEKTGNDWVPVTII
DVRGHSYLQENKIKTTDLHRPLHDEMPGNRPDVIESIDSQVLQEARPPLVSADDEIYSTS
KAFIGPIYKPPEKKKRNEGRNEAHVLNGINDRGGQKEKQKFNSEKSEIDNELFQFYKEIE
ELEKEKDGFENSCKESEPSQEQFVPFYEGHNNGLLKPDEEKKDLSNKAMPSHCDYQQNLG
NEPDKYPCNGQVIPTFCDTSFTSFRPEWQSVYPFIVPYGPPLPSLNYHLNIQRFSGPPNP
PSNIFQAQDDSQIQNGYYVNNCHVNWNCMTFDQNNEYTDCSENRSSVHPSGNGCSMQDRY
VSNGFCEVRERCWKDHCMDKHNGTDRFVNQQFQEEKLNKLQKLLILLRGLPGSGKTTLSR
ILLGQNRDGIVFSTDDYFHHQDGYRYNVNQLGDAHDWNQNRAKQAIDQGRSPVIIDNTNI
QAWEMKPYVEVAIGKGYRVEFHEPETWWKFDPEELEKRNKHGVSRKKIAQMLDRYEYQMS
ISIVMNSVEPSHKSTQRPPPPQGRQRWGGSLGSHNRVCVTNNH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q92802	1.000	1.000	4.439E-90	583	1.000	1.000	Q92802.pdb.gz	N42L2_HUMAN NEDD4-binding protein 2-like 2 OS=Homo sapiens OX=9606 GN=N4BP2L2 PE=1 SV=1
2	AFDB:Q8JZS6	0.352	0.357	2.022E-58	575	0.650	0.659	Q8JZS6.pdb.gz	N42L2_MOUSE NEDD4-binding protein 2-like 2 OS=Mus musculus OX=10090 GN=N4bp2l2 PE=2 SV=2
3	PDB:2ia5H	0.200	0.368	2.975E-8	301	0.069	0.133	2ia5H.pdb.gz	Structure-function analysis of the 3' phosphatase component of T4 polynucleotide kinase/phosphatase.
4	PDB:1k6mA	0.175	0.227	4.962E-5	432	0.048	0.065	1k6mA.pdb.gz	Tissue-specific structure/function differentiation of the liver isoform of 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase.
5	PDB:1ko5A	0.181	0.503	5.615E-5	172	0.034	0.116	1ko5A.pdb.gz	Conformational changes during the catalytic cycle of gluconate kinase as revealed by X-ray crystallography.
6	PDB:2axnA	0.194	0.244	1.934E-4	451	0.048	0.062	2axnA.pdb.gz	Crystal structure of the hypoxia-inducible form of 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase (PFKFB3): a possible new target for cancer therapy.
7	PDB:5htkA	0.188	0.249	5.885E-4	425	0.046	0.064	5htkA.pdb.gz	Crystal structure of heart 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase (PFKFB2) and the inhibitory influence of citrate on substrate binding.
8	PDB:1gvnB	0.149	0.304	9.651E-4	272	0.051	0.110	1gvnB.pdb.gz
9	AFDB:Q6PL18	0.126	0.063	2.546E-3	1390	0.125	0.053	Q6PL18.pdb.gz	ATAD2_HUMAN ATPase family AAA domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ATAD2 PE=1 SV=1
10	PDB:1kagA	0.148	0.398	4.256E-3	158	0.039	0.146	1kagA.pdb.gz
11	PDB:2a2zB	0.173	0.374	4.527E-3	221	0.038	0.100	2a2zB.pdb.gz	Structural basis for the preference of UTP over ATP in human deoxycytidine kinase: illuminating the role of main-chain reorganization.
12	PDB:1tevA	0.159	0.408	6.561E-3	194	0.036	0.108	1tevA.pdb.gz
13	PDB:2c95A	0.161	0.404	8.938E-3	195	0.050	0.149	2c95A.pdb.gz	Structure of Adenylate Kinase 1 in Complex with P1, P4-Di(Adenosine)Tetraphosphate
14	AFDB:Q9Y794	0.117	0.082	1.530E-2	972	0.161	0.097	Q9Y794.pdb.gz	ORC4_SCHPO Origin recognition complex subunit 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=orc4 PE=1 SV=1
15	AFDB:Q63803	0.056	0.034	5.268E-2	1144	0.130	0.066	Q63803.pdb.gz	GNAS1_RAT Guanine nucleotide-binding protein G(s) subunit alpha isoforms XLas OS=Rattus norvegicus OX=10116 GN=Gnas PE=1 SV=3
16	AFDB:F1R9D7	0.059	0.062	7.177E-2	542	0.123	0.133	F1R9D7.pdb.gz
17	AFDB:Q6R0H7	0.071	0.040	9.190E-2	1133	0.118	0.061	Q6R0H7.pdb.gz	GNAS1_MOUSE Guanine nucleotide-binding protein G(s) subunit alpha isoforms XLas OS=Mus musculus OX=10090 GN=Gnas PE=1 SV=1
18	AFDB:Q5JWF2	0.059	0.038	9.776E-2	1037	0.130	0.073	Q5JWF2.pdb.gz	GNAS1_HUMAN Guanine nucleotide-binding protein G(s) subunit alpha isoforms XLas OS=Homo sapiens OX=9606 GN=GNAS PE=1 SV=2
19	AFDB:F4IAE9	0.126	0.069	1.507E-1	1210	0.113	0.055	F4IAE9.pdb.gz	Y1591_ARATH ATPase family AAA domain-containing protein At1g05910 OS=Arabidopsis thaliana OX=3702 GN=At1g05910 PE=2 SV=1
20	AFDB:P39955	0.103	0.074	4.586E-1	897	0.151	0.098	P39955.pdb.gz	SAP1_YEAST Protein SAP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SAP1 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8JZS6	0.0	733	575	0.652	0.661	N42L2_MOUSE NEDD4-binding protein 2-like 2 OS=Mus musculus OX=10090 GN=N4bp2l2 PE=2 SV=2
2	Q92802	0.0	1221	583	1.000	1.000	N42L2_HUMAN NEDD4-binding protein 2-like 2 OS=Homo sapiens OX=9606 GN=N4BP2L2 PE=1 SV=1
3	Q8BX85	7.68e-46	175	836	0.132	0.092	Q8BX85_MOUSE NEDD4-binding protein 2-like 2 (Fragment) OS=Mus musculus OX=10090 GN=N4bp2 PE=2 SV=1
4	Q69ZK1	1.29e-45	176	1512	0.132	0.051	Q69ZK1_MOUSE MKIAA1413 protein (Fragment) OS=Mus musculus OX=10090 GN=N4bp2 PE=2 SV=1
5	A0A0J9YUP5	1.32e-45	176	1498	0.132	0.051	A0A0J9YUP5_MOUSE NEDD4 binding protein 2 (Fragment) OS=Mus musculus OX=10090 GN=N4bp2 PE=1 SV=3
6	F8VQG7	1.55e-45	175	1678	0.132	0.046	F8VQG7_MOUSE NEDD4 binding protein 2 OS=Mus musculus OX=10090 GN=N4bp2 PE=1 SV=1
7	Q86UW6	4.03e-45	174	1770	0.130	0.043	N4BP2_HUMAN NEDD4-binding protein 2 OS=Homo sapiens OX=9606 GN=N4BP2 PE=1 SV=2
8	K7ERC4	1.76e-10	62.0	164	0.062	0.220	K7ERC4_HUMAN 2',3'-cyclic nucleotide 3' phosphodiesterase (Fragment) OS=Homo sapiens OX=9606 GN=CNP PE=1 SV=8
9	K7ERZ0	4.02e-10	60.8	153	0.062	0.235	K7ERZ0_HUMAN 2',3'-cyclic nucleotide 3' phosphodiesterase (Fragment) OS=Homo sapiens OX=9606 GN=CNP PE=1 SV=8
10	P09543	1.18e-09	63.2	421	0.062	0.086	CN37_HUMAN 2',3'-cyclic-nucleotide 3'-phosphodiesterase OS=Homo sapiens OX=9606 GN=CNP PE=1 SV=2
11	P06623	2.07e-09	62.0	400	0.070	0.102	CN37_BOVIN 2',3'-cyclic-nucleotide 3'-phosphodiesterase OS=Bos taurus OX=9913 GN=CNP PE=1 SV=2
12	C9K0L8	2.45e-09	58.2	144	0.058	0.236	C9K0L8_HUMAN 2',3'-cyclic nucleotide 3' phosphodiesterase (Fragment) OS=Homo sapiens OX=9606 GN=CNP PE=1 SV=2
13	P16330	4.18e-08	58.2	420	0.062	0.086	CN37_MOUSE 2',3'-cyclic-nucleotide 3'-phosphodiesterase OS=Mus musculus OX=10090 GN=Cnp PE=1 SV=3
14	P13233	3.52e-07	55.1	420	0.060	0.083	CN37_RAT 2',3'-cyclic-nucleotide 3'-phosphodiesterase OS=Rattus norvegicus OX=10116 GN=Cnp PE=1 SV=2
15	P0CB49	0.003	43.1	1376	0.069	0.029	YLPM1_RAT YLP motif-containing protein 1 OS=Rattus norvegicus OX=10116 GN=Ylpm1 PE=1 SV=1
16	Q9R0I7	0.003	43.1	1386	0.069	0.029	YLPM1_MOUSE YLP motif-containing protein 1 OS=Mus musculus OX=10090 GN=Ylpm1 PE=2 SV=2
17	P49750	0.022	40.4	2146	0.067	0.018	YLPM1_HUMAN YLP motif-containing protein 1 OS=Homo sapiens OX=9606 GN=YLPM1 PE=1 SV=4
18	P06855	0.050	38.5	301	0.065	0.126	KIPN_BPT4 Polynucleotide kinase OS=Enterobacteria phage T4 OX=10665 GN=pseT PE=1 SV=1
19	Q19683	0.22	36.6	407	0.051	0.074	YZR5_CAEEL Uncharacterized protein F21D5.5 OS=Caenorhabditis elegans OX=6239 GN=F21D5.5 PE=2 SV=2
20	M9NGY4	0.41	36.2	1885	0.031	0.010	M9NGY4_DROME ZAP3, isoform E OS=Drosophila melanogaster OX=7227 GN=ZAP3 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13191 AAA_16	31	16.3	AAA ATPase domain
2	PF13238 AAA_18	0.13	24.3	AAA domain
3	PF13401 AAA_22	5.4e+02	12.3	AAA domain
4	PF13671 AAA_33	1.5e-11	56.1	AAA domain
5	PF00005 ABC_tran	4.2e+02	12.8	ABC transporter
6	PF08433 KTI12	2.7	18.9	Chromatin associated protein KTI12
7	PF02367 TsaE	5.4e+02	12.0	Threonylcarbamoyl adenosine biosynthesis protein TsaE
8	PF06414 Zeta_toxin	0.006	27.5	Zeta toxin

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_008950466.1

Rank	PPI partner	STRING score	Description
1	9597.XP_008975990.1	0.638	C2 domain-containing protein 2
2	9597.XP_003822771.1	0.592	RUN domain-containing protein 3B isoform X1
3	9597.XP_003818954.1	0.583	BTB/POZ domain-containing protein KCTD20
4	9597.XP_008968418.1	0.583	Family with sequence similarity 69 member B
5	9597.XP_003810105.1	0.576	Belongs to the TRAPP small subunits family.
6	9597.XP_003817278.1	0.559	Acyl-coenzyme A thioesterase THEM5
7	9597.XP_008974500.1	0.548	RUN domain-containing protein 3A
8	9597.XP_008961440.1	0.539	SS18L1, nBAF chromatin remodeling complex subunit
9	9597.XP_003821149.1	0.515	The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred CDS: inserted 1 base in 1 codon
10	9597.XP_003807066.1	0.508	tRNA (adenine(58)-N(1))-methyltransferase catalytic subunit TRMT61A
11	9597.XP_008952353.1	0.503	Phosphofurin acidic cluster sorting protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019899	1.000	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:2000736	0.934	regulation of stem cell differentiation
GO:1901532	0.921	regulation of hematopoietic progenitor cell differentiation
GO:0072091	0.919	regulation of stem cell proliferation
GO:0048522	0.839	positive regulation of cellular process
GO:2000737	0.800	negative regulation of stem cell differentiation
GO:1902036	0.798	regulation of hematopoietic stem cell differentiation
GO:0008284	0.760	positive regulation of cell population proliferation
GO:2000648	0.748	positive regulation of stem cell proliferation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0032991	0.988	protein-containing complex
GO:0031982	0.880	vesicle
GO:0005576	0.857	extracellular region
GO:0005615	0.622	extracellular space
GO:1903561	0.613	extracellular vesicle
GO:0070062	0.604	extracellular exosome
GO:0005667	0.577	transcription regulator complex
GO:0017053	0.549	transcription repressor complex
GO:0043233	0.445	organelle lumen
GO:0070013	0.442	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]