StarFunc result for job id Q92804

User Input

>input (592 residues)
MSDSGSYGQSGGEQQSYSTYGNPGSQGYGQASQSYSGYGQTTDSSYGQNYSGYSSYGQSQ
SGYSQSYGGYENQKQSSYSQQPYNNQGQQQNMESSGSQGGRAPSYDQPDYGQQDSYDQQS
GYDQHQGSYDEQSNYDQQHDSYSQNQQSYHSQRENYSHHTQDDRRDVSRYGEDNRGYGGS
QGGGRGRGGYDKDGRGPMTGSSGGDRGGFKNFGGHRDYGPRTDADSESDNSDNNTIFVQG
LGEGVSTDQVGEFFKQIGIIKTNKKTGKPMINLYTDKDTGKPKGEATVSFDDPPSAKAAI
DWFDGKEFHGNIIKVSFATRRPEFMRGGGSGGGRRGRGGYRGRGGFQGRGGDPKSGDWVC
PNPSCGNMNFARRNSCNQCNEPRPEDSRPSGGDFRGRGYGGERGYRGRGGRGGDRGGYGG
DRSGGGYGGDRSSGGGYSGDRSGGGYGGDRSGGGYGGDRGGGYGGDRGGGYGGDRGGGYG
GDRGGYGGDRGGGYGGDRGGYGGDRGGYGGDRGGYGGDRGGYGGDRSRGGYGGDRGGGSG
YGGDRSGGYGGDRSGGGYGGDRGGGYGGDRGGYGGKMGGRNDYRNDQRNRPY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q92804	0.999	0.999	4.283E-87	592	1.000	1.000	Q92804.pdb.gz	RBP56_HUMAN TATA-binding protein-associated factor 2N OS=Homo sapiens OX=9606 GN=TAF15 PE=1 SV=1
2	AFDB:F1R0M4	0.191	0.208	1.113E-32	541	0.390	0.427	F1R0M4.pdb.gz	F1R0M4_DANRE FUS RNA-binding protein OS=Danio rerio OX=7955 GN=zgc:56390 PE=1 SV=1
3	AFDB:A0A0R4IRM2	0.134	0.133	2.109E-14	596	0.316	0.314	A0A0R4IRM2.pdb.gz
4	PDB:7dvqY	0.136	0.550	6.862E-8	140	0.047	0.200	7dvqY.pdb.gz	Structure of the activated human minor spliceosome.
5	PDB:5xjcw	0.133	0.793	2.042E-7	91	0.041	0.264	5xjcw.pdb.gz	An Atomic Structure of the Human Spliceosome
6	PDB:7evoD	0.147	0.422	2.322E-7	200	0.037	0.110	7evoD.pdb.gz	Structural Insights into Branch Site Proofreading by Human Spliceosome.
7	PDB:5yzg1	0.127	0.302	2.476E-7	243	0.044	0.107	5yzg1.pdb.gz	Structure of a human catalytic step I spliceosome
8	PDB:6qx91K	0.134	0.378	3.200E-7	201	0.054	0.159	6qx91K.pdb.gz	Mechanism of 5' splice site transfer for human spliceosome activation.
9	PDB:6g90B	0.134	0.392	5.700E-7	193	0.049	0.150	6g90B.pdb.gz	Prespliceosome structure provides insights into spliceosome assembly and regulation.
10	PDB:5gm6V	0.137	0.593	8.932E-7	128	0.035	0.164	5gm6V.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
11	PDB:6y53o	0.128	0.456	1.083E-6	160	0.041	0.150	6y53o.pdb.gz	Molecular architecture of the human 17S U2 snRNP.
12	PDB:1hl6A	0.127	0.591	1.929E-6	119	0.044	0.218	1hl6A.pdb.gz
13	PDB:6n7pA	0.132	0.405	2.338E-6	186	0.042	0.134	6n7pA.pdb.gz	A unified mechanism for intron and exon definition and back-splicing.
14	AFDB:Q9P789	0.138	0.080	3.727E-6	1065	0.093	0.052	Q9P789.pdb.gz	YN8E_SCHPO Pumilio domain-containing protein P35G2.14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBP35G2.14 PE=1 SV=2
15	AFDB:A8JNQ4	0.132	0.100	4.518E-6	796	0.101	0.075	A8JNQ4.pdb.gz	A8JNQ4_DROME RNA-binding Fox protein 1, isoform I OS=Drosophila melanogaster OX=7227 GN=Rbfox1 PE=4 SV=2
16	AFDB:Q96EV2	0.120	0.064	2.395E-5	1170	0.064	0.032	Q96EV2.pdb.gz	RBM33_HUMAN RNA-binding protein 33 OS=Homo sapiens OX=9606 GN=RBM33 PE=1 SV=3
17	AFDB:Q8SY33	0.138	0.066	8.642E-5	1384	0.115	0.049	Q8SY33.pdb.gz	GAWKY_DROME Protein Gawky OS=Drosophila melanogaster OX=7227 GN=gw PE=1 SV=1
18	AFDB:Q9UKV3	0.126	0.059	4.885E-4	1341	0.078	0.034	Q9UKV3.pdb.gz	ACINU_HUMAN Apoptotic chromatin condensation inducer in the nucleus OS=Homo sapiens OX=9606 GN=ACIN1 PE=1 SV=2
19	AFDB:Q5VV67	0.136	0.053	3.140E-3	1664	0.079	0.028	Q5VV67.pdb.gz	PPRC1_HUMAN Peroxisome proliferator-activated receptor gamma coactivator-related protein 1 OS=Homo sapiens OX=9606 GN=PPRC1 PE=1 SV=1
20	AFDB:Q9JIX8	0.127	0.059	3.806E-3	1338	0.083	0.037	Q9JIX8.pdb.gz	ACINU_MOUSE Apoptotic chromatin condensation inducer in the nucleus OS=Mus musculus OX=10090 GN=Acin1 PE=1 SV=3

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q3TLE4	0.0	638	518	0.630	0.720	Q3TLE4_MOUSE TATA-binding protein-associated factor 2N OS=Mus musculus OX=10090 GN=Taf15 PE=2 SV=1
2	Q8BQ46	0.0	639	557	0.630	0.670	Q8BQ46_MOUSE TAF15 RNA polymerase II, TATA box binding protein (TBP)-associated factor OS=Mus musculus OX=10090 GN=Taf15 PE=1 SV=1
3	Q92804	0.0	1072	592	1.000	1.000	RBP56_HUMAN TATA-binding protein-associated factor 2N OS=Homo sapiens OX=9606 GN=TAF15 PE=1 SV=1
4	Q3V452	1.85e-89	276	200	0.307	0.910	Q3V452_MOUSE TATA-binding protein-associated factor 2N OS=Mus musculus OX=10090 GN=Taf15 PE=2 SV=1
5	Q6J4Y8	1.54e-67	229	504	0.206	0.242	Q6J4Y8_CHICK FUS/TLS OS=Gallus gallus OX=9031 PE=1 SV=1
6	P56959	1.06e-64	222	518	0.204	0.234	FUS_MOUSE RNA-binding protein FUS OS=Mus musculus OX=10090 GN=Fus PE=1 SV=1
7	P35637	2.71e-64	221	526	0.204	0.230	FUS_HUMAN RNA-binding protein FUS OS=Homo sapiens OX=9606 GN=FUS PE=1 SV=1
8	Q6IBQ5	2.71e-64	221	526	0.204	0.230	Q6IBQ5_HUMAN FUS protein OS=Homo sapiens OX=9606 GN=FUS PE=2 SV=1
9	H3BPE7	3.63e-64	221	527	0.203	0.228	H3BPE7_HUMAN FUS RNA binding protein OS=Homo sapiens OX=9606 GN=FUS PE=1 SV=1
10	Q5PQK2	6.94e-64	220	518	0.203	0.232	Q5PQK2_RAT FUS RNA binding protein OS=Rattus norvegicus OX=10116 GN=Fus PE=3 SV=1
11	F1R0M4	1.95e-53	192	541	0.194	0.213	F1R0M4_DANRE FUS RNA-binding protein OS=Danio rerio OX=7955 GN=zgc:56390 PE=1 SV=1
12	Q01844	3.01e-52	191	656	0.172	0.155	EWS_HUMAN RNA-binding protein EWS OS=Homo sapiens OX=9606 GN=EWSR1 PE=1 SV=1
13	A0A140UHY3	3.06e-49	183	661	0.164	0.147	A0A140UHY3_RAT EWS RNA-binding protein 1 OS=Rattus norvegicus OX=10116 GN=Ewsr1 PE=3 SV=1
14	B1WC50	3.49e-49	183	655	0.164	0.148	B1WC50_RAT EWS RNA-binding protein 1 OS=Rattus norvegicus OX=10116 GN=Ewsr1 PE=3 SV=1
15	Q61545	4.04e-49	183	655	0.166	0.150	EWS_MOUSE RNA-binding protein EWS OS=Mus musculus OX=10090 GN=Ewsr1 PE=1 SV=2
16	B0QYK0	1.83e-48	180	618	0.152	0.146	B0QYK0_HUMAN EWS RNA binding protein 1 OS=Homo sapiens OX=9606 GN=EWSR1 PE=1 SV=1
17	A0A0G2K850	2.71e-48	180	618	0.150	0.144	A0A0G2K850_RAT EWS RNA-binding protein 1 OS=Rattus norvegicus OX=10116 GN=Ewsr1 PE=1 SV=2
18	Q4KM41	4.69e-48	172	317	0.160	0.300	Q4KM41_RAT Ewing sarcoma breakpoint region 1 OS=Rattus norvegicus OX=10116 GN=Ewsr1 PE=2 SV=1
19	A0A8J8Y9N6	8.05e-48	179	654	0.150	0.136	A0A8J8Y9N6_RAT EWS RNA-binding protein 1 OS=Rattus norvegicus OX=10116 GN=Ewsr1 PE=1 SV=1
20	Q4QRG0	1.39e-40	157	579	0.150	0.154	Q4QRG0_DANRE EWS RNA-binding protein 1b OS=Danio rerio OX=7955 GN=fb40b11 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00076 RRM_1	5e-07	40.8	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
2	PF00641 zf-RanBP	0.0013	29.3	Zn-finger in Ran binding protein and others

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000474096

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000354346	0.977	Matrin-3
2	9606.ENSP00000240185	0.970	TAR DNA-binding protein 43
3	9606.ENSP00000349168	0.967	Heterogeneous nuclear ribonucleoprotein H
4	9606.ENSP00000341826	0.961	Heterogeneous nuclear ribonucleoprotein A1
5	9606.ENSP00000363745	0.961	Heterogeneous nuclear ribonucleoprotein R
6	9606.ENSP00000365439	0.956	Heterogeneous nuclear ribonucleoprotein K
7	9606.ENSP00000385269	0.956	ELAV-like protein 1
8	9606.ENSP00000346694	0.953	Heterogeneous nuclear ribonucleoproteins A2/B1
9	9606.ENSP00000325376	0.952	Heterogeneous nuclear ribonucleoprotein M
10	9606.ENSP00000379475	0.949	Spliceosome RNA helicase DDX39B
11	9606.ENSP00000258962	0.947	Serine/arginine-rich splicing factor 1
12	9606.ENSP00000221419	0.946	Heterogeneous nuclear ribonucleoprotein L
13	9606.ENSP00000342374	0.941	Small nuclear ribonucleoprotein Sm D2
14	9606.ENSP00000451291	0.939	Heterogeneous nuclear ribonucleoproteins C1/C2
15	9606.ENSP00000451080	0.937	Enhancer of rudimentary homolog
16	9606.ENSP00000375942	0.930	TATA-box-binding protein
17	9606.ENSP00000416959	0.927	Transformer-2 protein homolog beta
18	9606.ENSP00000400591	0.925	Small nuclear ribonucleoprotein E
19	9606.ENSP00000272348	0.924	Small nuclear ribonucleoprotein G
20	9606.ENSP00000358854	0.920	Transcription initiation factor TFIID subunit 5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003730	0.998	mRNA 3'-UTR binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043170	0.998	macromolecule metabolic process
GO:0009987	0.995	cellular process
GO:0044238	0.993	primary metabolic process
GO:0044237	0.993	cellular metabolic process
GO:0006807	0.990	nitrogen compound metabolic process
GO:0016070	0.983	RNA metabolic process
GO:0010467	0.982	gene expression
GO:0008380	0.958	RNA splicing
GO:0065007	0.916	biological regulation
GO:0050789	0.913	regulation of biological process
GO:0050794	0.859	regulation of cellular process
GO:0060255	0.847	regulation of macromolecule metabolic process
GO:0080090	0.802	regulation of primary metabolic process
GO:0051171	0.802	regulation of nitrogen compound metabolic process
GO:0031323	0.793	regulation of cellular metabolic process
GO:0048518	0.782	positive regulation of biological process
GO:0051252	0.775	regulation of RNA metabolic process
GO:0010468	0.742	regulation of gene expression
GO:0048522	0.736	positive regulation of cellular process
GO:0009893	0.693	positive regulation of metabolic process
GO:0010604	0.662	positive regulation of macromolecule metabolic process
GO:0048519	0.657	negative regulation of biological process
GO:0009889	0.647	regulation of biosynthetic process
GO:0051173	0.639	positive regulation of nitrogen compound metabolic process
GO:0031325	0.639	positive regulation of cellular metabolic process
GO:0031326	0.589	regulation of cellular biosynthetic process
GO:0010556	0.584	regulation of macromolecule biosynthetic process
GO:0048523	0.541	negative regulation of cellular process
GO:0045935	0.508	positive regulation of nucleobase-containing compound metabolic process
GO:0006355	0.447	regulation of DNA-templated transcription
GO:0009892	0.445	negative regulation of metabolic process
GO:0010605	0.418	negative regulation of macromolecule metabolic process
GO:0051254	0.356	positive regulation of RNA metabolic process
GO:0051172	0.353	negative regulation of nitrogen compound metabolic process
GO:0031324	0.350	negative regulation of cellular metabolic process
GO:0045934	0.320	negative regulation of nucleobase-containing compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0005737	0.999	cytoplasm
GO:0032991	0.769	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]