StarFunc result for job id Q92817

User Input

>input (2033 residues)
MFKGLSKGSQGKGSPKGSPAKGSPKGSPSRHSRAATQELALLISRMQANADQVERDILET
QKRLQQDRLNSEQSQALQHQQETGRSLKEAEVLLKDLFLDVDKARRLKHPQAEEIEKDIK
QLHERVTQECAEYRALYEKMVLPPDVGPRVDWARVLEQKQKQVCAGQYGPGMAELEQQIA
EHNILQKEIDAYGQQLRSLVGPDAATIRSQYRDLLKAASWRGQSLGSLYTHLQGCTRQLS
ALAEQQRRILQQDWSDLMADPAGVRREYEHFKQHELLSQEQSVNQLEDDGERMVELRHPA
VGPIQAHQEALKMEWQNFLNLCICQETQLQHVEDYRRFQEEADSVSQTLAKLNSNLDAKY
SPAPGGPPGAPTELLQQLEAEEKRLAVTERATGDLQRRSRDVAPLPQRRNPPQQPLHVDS
ICDWDSGEVQLLQGERYKLVDNTDPHAWVVQGPGGETKRAPAACFCIPAPDPDAVARASR
LASELQALKQKLATVQSRLKASAVESLRPSQQAPSGSDLANPQAQKLLTQMTRLDGDLGQ
IERQVLAWARAPLSRPTPLEDLEGRIHSHEGTAQRLQSLGTEKETAQKECEAFLSTRPVG
PAALQLPVALNSVKNKFSDVQVLCSLYGEKAKAALDLERQIQDADRVIRGFEATLVQEAP
IPAEPGALQERVSELQRQRRELLEQQTCVLRLHRALKASEHACAALQNNFQEFCQDLPRQ
QRQVRALTDRYHAVGDQLDLREKVVQDAALTYQQFKNCKDNLSSWLEHLPRSQVRPSDGP
SQIAYKLQAQKRLTQEIQSRERDRATASHLSQALQAALQDYELQADTYRCSLEPTLAVSA
PKRPRVAPLQESIQAQEKNLAKAYTEVAAAQQQLLQQLEFARKMLEKKELSEDIRRTHDA
KQGSESPAQAGRESEALKAQLEEERKRVARVQHELEAQRSQLLQLRTQRPLERLEEKEVV
EFYRDPQLEGSLSRVKAQVEEEGKRRAGLQADLEVAAQKVVQLESKRKTMQPHLLTKEVT
QVERDPGLDSQAAQLRIQIQQLRGEDAVISARLEGLKKELLALEKREVDVKEKVVVKEVV
KVEKNLEMVKAAQALRLQMEEDAARRKQAEEAVAKLQARIEDLERAISSVEPKVIVKEVK
KVEQDPGLLQESSRLRSLLEEERTKNATLARELSDLHSKYSVVEKQRPKVQLQERVHEIF
QVDPETEQEITRLKAKLQEMAGKRSGVEKEVEKLLPDLEVLRAQKPTVEYKEVTQEVVRH
ERSPEVLREIDRLKAQLNELVNSHGRSQEQLIRLQGERDEWRRERAKVETKTVSKEVVRH
EKDPVLEKEAERLRQEVREAAQKRRAAEDAVYELQSKRLLLERRKPEEKVVVQEVVVTQK
DPKLREEHSRLSGSLDEEVGRRRQLELEVQQLRAGVEEQEGLLSFQEDRSKKLAVERELR
QLTLRIQELEKRPPTVQEKIIMEEVVKLEKDPDLEKSTEALRWDLDQEKTQVTELNRECK
NLQVQIDVLQKAKSQEKTIYKEVIRVQKDRVLEDERARVWEMLNRERTARQAREEEARRL
RERIDRAETLGRTWSREESELQRARDQADQECGRLQQELRALERQKQQQTLQLQEESKLL
SQKTESERQKAAQRGQELSRLEAAILREKDQIYEKERTLRDLHAKVSREELSQETQTRET
NLSTKISILEPETGKDMSPYEAYKRGIIDRGQYLQLQELECDWEEVTTSGPCGEESVLLD
RKSGKQYSIEAALRCRRISKEEYHLYKDGHLPISEFALLVAGETKPSSSLSIGSIISKSP
LASPAPQSTSFFSPSFSLGLGDDSFPIAGIYDTTTDNKCSIKTAVAKNMLDPITGQKLLE
AQAATGGIVDLLSRERYSVHKAMERGLIENTSTQRLLNAQKAFTGIEDPVTKKRLSVGEA
VQKGWMPRESVLPHLQVQHLTGGLIDPKRTGRIPIQQALLSGMISEELAQLLQDESSYEK
DLTDPISKERLSYKEAMGRCRKDPLSGLLLLPAALEGYRCYRSASPTVPRSLR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q92817	1.000	1.000	0.000	2033	1.000	1.000	Q92817.pdb.gz	EVPL_HUMAN Envoplakin OS=Homo sapiens OX=9606 GN=EVPL PE=1 SV=3
2	AFDB:Q9D952	0.201	0.201	0.000	2035	0.828	0.827	Q9D952.pdb.gz	EVPL_MOUSE Envoplakin OS=Mus musculus OX=10090 GN=Evpl PE=1 SV=3
3	AFDB:O60437	0.190	0.215	1.792E-76	1756	0.256	0.296	O60437.pdb.gz	PEPL_HUMAN Periplakin OS=Homo sapiens OX=9606 GN=PPL PE=1 SV=4
4	AFDB:Q9R269	0.217	0.247	8.469E-73	1755	0.259	0.300	Q9R269.pdb.gz	PEPL_MOUSE Periplakin OS=Mus musculus OX=10090 GN=Ppl PE=1 SV=1
5	AFDB:P13395	0.122	0.106	7.595E-13	2415	0.107	0.090	P13395.pdb.gz	SPTCA_DROME Spectrin alpha chain OS=Drosophila melanogaster OX=7227 GN=alpha-Spec PE=1 SV=2
6	AFDB:D4A678	0.121	0.105	4.510E-12	2416	0.122	0.103	D4A678.pdb.gz	D4A678_RAT Spectrin, alpha, erythrocytic 1 OS=Rattus norvegicus OX=10116 GN=Spta1 PE=1 SV=4
7	AFDB:O15020	0.091	0.080	1.348E-9	2390	0.104	0.088	O15020.pdb.gz	SPTN2_HUMAN Spectrin beta chain, non-erythrocytic 2 OS=Homo sapiens OX=9606 GN=SPTBN2 PE=1 SV=3
8	AFDB:Q6ZMZ3	0.122	0.233	5.360E-9	975	0.071	0.148	Q6ZMZ3.pdb.gz	SYNE3_HUMAN Nesprin-3 OS=Homo sapiens OX=9606 GN=SYNE3 PE=1 SV=2
9	AFDB:Q503P9	0.107	0.263	9.997E-9	786	0.042	0.109	Q503P9.pdb.gz
10	AFDB:Q8MRH2	0.119	0.213	2.330E-8	1025	0.062	0.124	Q8MRH2.pdb.gz	Q8MRH2_DROME LP04011p OS=Drosophila melanogaster OX=7227 GN=kst PE=2 SV=1
11	PDB:1tr2B	0.051	0.073	9.360E-3	1029	0.056	0.110	1tr2B.pdb.gz
12	PDB:6bfiB	0.054	0.110	1.037E-1	806	0.046	0.115	6bfiB.pdb.gz
13	PDB:7qpgW	0.050	0.100	1.185E-1	779	0.050	0.130	7qpgW.pdb.gz
14	PDB:7ktuA	0.044	0.077	1.295E-1	995	0.055	0.112	7ktuA.pdb.gz
15	PDB:3qwyA	0.025	0.283	1.548E-1	170	0.006	0.071	3qwyA.pdb.gz
16	PDB:1sjjA	0.080	0.149	1.618E-1	863	0.025	0.058	1sjjA.pdb.gz
17	PDB:4iggB	0.051	0.112	1.618E-1	771	0.039	0.104	4iggB.pdb.gz
18	PDB:6wg3D	0.061	0.097	1.692E-1	932	0.051	0.112	6wg3D.pdb.gz	Cryo-EM structure of the human cohesin-NIPBL-DNA complex.
19	PDB:7q2xD	0.059	0.097	1.769E-1	994	0.040	0.081	7q2xD.pdb.gz	Clamping of DNA shuts the condensin neck gate.
20	PDB:1griA	0.027	0.234	2.022E-1	211	0.009	0.085	1griA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	K7EKI0	0.0	4059	2055	1.000	0.989	K7EKI0_HUMAN Envoplakin OS=Homo sapiens OX=9606 GN=EVPL PE=1 SV=1
2	O60437	0.0	672	1756	0.267	0.309	PEPL_HUMAN Periplakin OS=Homo sapiens OX=9606 GN=PPL PE=1 SV=4
3	Q92817	0.0	4073	2033	1.000	1.000	EVPL_HUMAN Envoplakin OS=Homo sapiens OX=9606 GN=EVPL PE=1 SV=3
4	Q9D952	0.0	3262	2035	0.828	0.828	EVPL_MOUSE Envoplakin OS=Mus musculus OX=10090 GN=Evpl PE=1 SV=3
5	Q9R269	0.0	673	1755	0.262	0.304	PEPL_MOUSE Periplakin OS=Mus musculus OX=10090 GN=Ppl PE=1 SV=1
6	Q15149	2.95e-71	269	4684	0.072	0.031	PLEC_HUMAN Plectin OS=Homo sapiens OX=9606 GN=PLEC PE=1 SV=3
7	Q9JI55	3.49e-71	269	4473	0.072	0.033	PLEC_CRIGR Plectin (Fragment) OS=Cricetulus griseus OX=10029 GN=PLEC PE=1 SV=1
8	Q9QXS1	1.17e-70	267	4691	0.071	0.031	PLEC_MOUSE Plectin OS=Mus musculus OX=10090 GN=Plec PE=1 SV=3
9	P30427	5.03e-70	265	4687	0.072	0.031	PLEC_RAT Plectin OS=Rattus norvegicus OX=10116 GN=Plec PE=1 SV=2
10	A0A0R4IJ71	1.11e-69	264	4506	0.070	0.032	A0A0R4IJ71_DANRE Plectin b OS=Danio rerio OX=7955 GN=si:ch211-165e15.1 PE=1 SV=2
11	E9QCV2	1.40e-69	264	4530	0.070	0.032	E9QCV2_DANRE Plectin b OS=Danio rerio OX=7955 GN=si:ch211-165e15.1 PE=1 SV=1
12	A5WV02	2.24e-69	263	4577	0.070	0.031	A5WV02_DANRE Plectin OS=Danio rerio OX=7955 GN=fa95h11 PE=1 SV=1
13	A0A2R8PVX9	2.33e-69	263	4580	0.070	0.031	A0A2R8PVX9_DANRE Plectin a OS=Danio rerio OX=7955 GN=fa95h11 PE=1 SV=1
14	H0YDN1	2.74e-69	263	3447	0.072	0.042	H0YDN1_HUMAN Plectin OS=Homo sapiens OX=9606 GN=PLEC PE=1 SV=9
15	A0A286YBE9	3.58e-69	262	4773	0.070	0.030	A0A286YBE9_DANRE Plectin a OS=Danio rerio OX=7955 GN=fa95h11 PE=1 SV=1
16	A0A2R8RIJ1	3.66e-69	262	4599	0.070	0.031	A0A2R8RIJ1_DANRE Plectin a OS=Danio rerio OX=7955 GN=fa95h11 PE=1 SV=1
17	E7F8G7	3.73e-69	262	4762	0.070	0.030	E7F8G7_DANRE Plectin a OS=Danio rerio OX=7955 GN=fa95h11 PE=1 SV=1
18	P15924	6.32e-66	251	2871	0.072	0.051	DESP_HUMAN Desmoplakin OS=Homo sapiens OX=9606 GN=DSP PE=1 SV=3
19	E9Q557	8.33e-65	248	2883	0.071	0.050	DESP_MOUSE Desmoplakin OS=Mus musculus OX=10090 GN=Dsp PE=1 SV=1
20	F1LMV6	6.10e-64	245	2877	0.071	0.050	DESP_RAT Desmoplakin OS=Rattus norvegicus OX=10116 GN=Dsp PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01638 HxlR	4e+02	12.3	HxlR-like helix-turn-helix
2	PF00681 Plectin	2.6e-45	163.3	Plectin repeat
3	PF17902 SH3_10	2.3e-19	80.5	SH3 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000301607

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000340510	0.996	Periplakin
2	9606.ENSP00000220420	0.924	Protein-glutamine gamma-glutamyltransferase 5
3	9606.ENSP00000393417	0.914	Caspase-14
4	9606.ENSP00000271971	0.893	Calpain-9
5	9606.ENSP00000357753	0.873	Involucrin
6	9606.ENSP00000357731	0.866	Loricrin
7	9606.ENSP00000361423	0.852	Tyrosine-protein kinase ABL1
8	9606.ENSP00000331678	0.842	Plakophilin-3
9	9606.ENSP00000440847	0.836	Zinc finger protein 185
10	9606.ENSP00000257189	0.829	Desmoglein-3
11	9606.ENSP00000257192	0.827	Desmoglein-1
12	9606.ENSP00000334644	0.825	Late cornified envelope protein 3C
13	9606.ENSP00000299698	0.802	Alpha-2-macroglobulin-like protein 1
14	9606.ENSP00000206765	0.797	Protein-glutamine gamma-glutamyltransferase K
15	9606.ENSP00000365465	0.795	Corneodesmosin
16	9606.ENSP00000340937	0.783	Collagen alpha-1(XVII) chain
17	9606.ENSP00000306461	0.767	Cornifin-B
18	9606.ENSP00000346484	0.764	Serine/threonine-protein kinase MAK
19	9606.ENSP00000317895	0.749	Repetin
20	9606.ENSP00000330391	0.730	Small proline-rich protein 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005198	1.000	structural molecule activity
GO:0045296	1.000	cadherin binding
GO:1901363	0.372	heterocyclic compound binding
GO:0097159	0.372	organic cyclic compound binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.988	cellular process
GO:0048856	0.979	anatomical structure development
GO:0071704	0.967	organic substance metabolic process
GO:0050789	0.965	regulation of biological process
GO:0044238	0.962	primary metabolic process
GO:0036211	0.952	protein modification process
GO:0009888	0.949	tissue development
GO:0030154	0.935	cell differentiation
GO:0048513	0.925	animal organ development
GO:0008544	0.921	epidermis development
GO:0043588	0.892	skin development
GO:0030855	0.881	epithelial cell differentiation
GO:0018149	0.862	peptide cross-linking
GO:0030216	0.812	keratinocyte differentiation
GO:0048583	0.783	regulation of response to stimulus
GO:0019222	0.744	regulation of metabolic process
GO:0002682	0.707	regulation of immune system process
GO:0060255	0.692	regulation of macromolecule metabolic process
GO:0050776	0.678	regulation of immune response
GO:0002920	0.650	regulation of humoral immune response
GO:0002697	0.642	regulation of immune effector process
GO:0050794	0.579	regulation of cellular process
GO:0010468	0.493	regulation of gene expression
GO:0002700	0.455	regulation of production of molecular mediator of immune response
GO:0032101	0.415	regulation of response to external stimulus
GO:0002831	0.413	regulation of response to biotic stimulus
GO:0050896	0.360	response to stimulus
GO:0080134	0.323	regulation of response to stress
GO:0002786	0.300	regulation of antibacterial peptide production

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005856	0.999	cytoskeleton
GO:0043227	0.995	membrane-bounded organelle
GO:0005886	0.995	plasma membrane
GO:0005576	0.987	extracellular region
GO:0070062	0.972	extracellular exosome
GO:0045111	0.933	intermediate filament cytoskeleton
GO:0001533	0.907	cornified envelope
GO:0043231	0.799	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]