StarFunc result for job id Q92823

User Input

>input (1304 residues)
MQLKIMPKKKRLSAGRVPLILFLCQMISALEVPLDPKLLEDLVQPPTITQQSPKDYIIDP
RENIVIQCEAKGKPPPSFSWTRNGTHFDIDKDPLVTMKPGTGTLIINIMSEGKAETYEGV
YQCTARNERGAAVSNNIVVRPSRSPLWTKEKLEPITLQSGQSLVLPCRPPIGLPPPIIFW
MDNSFQRLPQSERVSQGLNGDLYFSNVLPEDTREDYICYARFNHTQTIQQKQPISVKVIS
VDELNDTIAANLSDTEFYGAKSSRERPPTFLTPEGNASNKEELRGNVLSLECIAEGLPTP
IIYWAKEDGMLPKNRTVYKNFEKTLQIIHVSEADSGNYQCIAKNALGAIHHTISVRVKAA
PYWITAPQNLVLSPGEDGTLICRANGNPKPRISWLTNGVPIEIAPDDPSRKIDGDTIIFS
NVQERSSAVYQCNASNEYGYLLANAFVNVLAEPPRILTPANTLYQVIANRPALLDCAFFG
SPLPTIEWFKGAKGSALHEDIYVLHENGTLEIPVAQKDSTGTYTCVARNKLGMAKNEVHL
EIKDPTWIVKQPEYAVVQRGSMVSFECKVKHDHTLSLTVLWLKDNRELPSDERFTVDKDH
LVVADVSDDDSGTYTCVANTTLDSVSASAVLSVVAPTPTPAPVYDVPNPPFDLELTDQLD
KSVQLSWTPGDDNNSPITKFIIEYEDAMHKPGLWHHQTEVSGTQTTAQLKLSPYVNYSFR
VMAVNSIGKSLPSEASEQYLTKASEPDKNPTAVEGLGSEPDNLVITWKPLNGFESNGPGL
QYKVSWRQKDGDDEWTSVVVANVSKYIVSGTPTFVPYLIKVQALNDMGFAPEPAVVMGHS
GEDLPMVAPGNVRVNVVNSTLAEVHWDPVPLKSIRGHLQGYRIYYWKTQSSSKRNRRHIE
KKILTFQGSKTHGMLPGLEPFSHYTLNVRVVNGKGEGPASPDRVFNTPEGVPSAPSSLKI
VNPTLDSLTLEWDPPSHPNGILTEYTLKYQPINSTHELGPLVDLKIPANKTRWTLKNLNF
STRYKFYFYAQTSAGSGSQITEEAVTTVDEAGILPPDVGAGKVQAVNPRISNLTAAAAET
YANISWEYEGPEHVNFYVEYGVAGSKEEWRKEIVNGSRSFFGLKGLMPGTAYKVRVGAVG
DSGFVSSEDVFETGPAMASRQVDIATQGWFIGLMCAVALLILILLIVCFIRRNKGGKYPV
KEKEDAHADPEIQPMKEDDGTFGEYSDAEDHKPLKKGSRTPSDRTVKKEDSDDSLVDYGE
GVNGQFNEDGSFIGQYSGKKEKEPAEGNESSEAPSPVNAMNSFV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O94856	0.398	0.387	0.000	1347	0.487	0.471	O94856.pdb.gz	NFASC_HUMAN Neurofascin OS=Homo sapiens OX=9606 GN=NFASC PE=1 SV=4
2	AFDB:P35331	0.448	0.455	0.000	1284	0.781	0.794	P35331.pdb.gz	NRCAM_CHICK Neuronal cell adhesion molecule OS=Gallus gallus OX=9031 PE=1 SV=1
3	AFDB:P97685	0.413	0.433	0.000	1240	0.448	0.471	P97685.pdb.gz	NFASC_RAT Neurofascin OS=Rattus norvegicus OX=10116 GN=Nfasc PE=1 SV=2
4	AFDB:P97686	0.446	0.475	0.000	1214	0.864	0.928	P97686.pdb.gz	NRCAM_RAT Neuronal cell adhesion molecule OS=Rattus norvegicus OX=10116 GN=Nrcam PE=1 SV=2
5	AFDB:Q810U4	0.423	0.438	0.000	1256	0.896	0.930	Q810U4.pdb.gz	NRCAM_MOUSE Neuronal cell adhesion molecule OS=Mus musculus OX=10090 GN=Nrcam PE=1 SV=2
6	AFDB:Q90933	0.339	0.344	0.000	1280	0.360	0.367	Q90933.pdb.gz	Q90933_CHICK Neuron-glia cell adhesion molecule (Ng-CAM) OS=Gallus gallus OX=9031 PE=2 SV=1
7	AFDB:Q92823	1.000	1.000	0.000	1304	1.000	1.000	Q92823.pdb.gz	NRCAM_HUMAN Neuronal cell adhesion molecule OS=Homo sapiens OX=9606 GN=NRCAM PE=1 SV=3
8	AFDB:M0RC17	0.388	0.416	3.563E-101	1210	0.364	0.393	M0RC17.pdb.gz	M0RC17_RAT Cell adhesion molecule L1-like OS=Rattus norvegicus OX=10116 GN=Chl1 PE=1 SV=3
9	AFDB:Q90478	0.282	0.306	2.398E-100	1197	0.344	0.374	Q90478.pdb.gz	L1CA1_DANRE Neural cell adhesion molecule L1.1 (Fragment) OS=Danio rerio OX=7955 GN=nadl1.1 PE=2 SV=1
10	AFDB:Q63198	0.312	0.378	2.253E-75	1021	0.202	0.259	Q63198.pdb.gz	CNTN1_RAT Contactin-1 OS=Rattus norvegicus OX=10116 GN=Cntn1 PE=1 SV=2
11	PDB:5oj2B	0.127	0.198	7.084E-26	692	0.113	0.214	5oj2B.pdb.gz
12	PDB:1e07A	0.108	0.198	1.922E-17	642	0.084	0.170	1e07A.pdb.gz
13	PDB:5a42A	0.102	0.089	2.195E-17	1597	0.091	0.075	5a42A.pdb.gz
14	PDB:7sqcO0	0.106	0.118	1.486E-14	1140	0.086	0.098	7sqcO0.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
15	PDB:4ziqA	0.102	0.094	2.118E-14	1450	0.077	0.069	4ziqA.pdb.gz
16	PDB:6dldD	0.115	0.433	2.124E-13	269	0.048	0.230	6dldD.pdb.gz
17	PDB:7q1yA	0.091	0.088	2.426E-13	1374	0.074	0.070	7q1yA.pdb.gz
18	PDB:7vonA	0.092	0.088	6.435E-13	1399	0.064	0.060	7vonA.pdb.gz
19	PDB:7q5zA	0.096	0.094	1.251E-12	1344	0.064	0.062	7q5zA.pdb.gz
20	PDB:8eyyA	0.131	0.211	1.429E-12	775	0.049	0.083	8eyyA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I5Y8T8	0.0	840	1209	0.387	0.417	A0A8I5Y8T8_RAT Cell adhesion molecule L1-like OS=Rattus norvegicus OX=10116 GN=Chl1 PE=3 SV=1
2	A0A8I5YCG7	0.0	789	1177	0.374	0.415	A0A8I5YCG7_RAT Cell adhesion molecule L1-like OS=Rattus norvegicus OX=10116 GN=Chl1 PE=3 SV=1
3	A0A8I6A9A6	0.0	743	1170	0.315	0.351	A0A8I6A9A6_RAT Cell adhesion molecule L1-like OS=Rattus norvegicus OX=10116 GN=Chl1 PE=3 SV=1
4	M0RC17	0.0	857	1224	0.392	0.417	M0RC17_RAT Cell adhesion molecule L1-like OS=Rattus norvegicus OX=10116 GN=Chl1 PE=1 SV=3
5	O00533	0.0	848	1208	0.390	0.421	NCHL1_HUMAN Neural cell adhesion molecule L1-like protein OS=Homo sapiens OX=9606 GN=CHL1 PE=1 SV=4
6	O94856	0.0	1035	1347	0.387	0.374	NFASC_HUMAN Neurofascin OS=Homo sapiens OX=9606 GN=NFASC PE=1 SV=4
7	P11627	0.0	877	1260	0.388	0.402	L1CAM_MOUSE Neural cell adhesion molecule L1 OS=Mus musculus OX=10090 GN=L1cam PE=1 SV=1
8	P32004	0.0	878	1257	0.386	0.400	L1CAM_HUMAN Neural cell adhesion molecule L1 OS=Homo sapiens OX=9606 GN=L1CAM PE=1 SV=2
9	P35331	0.0	2156	1284	0.797	0.809	NRCAM_CHICK Neuronal cell adhesion molecule OS=Gallus gallus OX=9031 PE=1 SV=1
10	P70232	0.0	849	1209	0.390	0.420	NCHL1_MOUSE Neural cell adhesion molecule L1-like protein OS=Mus musculus OX=10090 GN=Chl1 PE=1 SV=2
11	P97685	0.0	901	1240	0.349	0.367	NFASC_RAT Neurofascin OS=Rattus norvegicus OX=10116 GN=Nfasc PE=1 SV=2
12	P97686	0.0	2045	1214	0.751	0.806	NRCAM_RAT Neuronal cell adhesion molecule OS=Rattus norvegicus OX=10116 GN=Nrcam PE=1 SV=2
13	Q03696	0.0	691	1266	0.352	0.363	NGCA_CHICK Neuronal-glial cell adhesion molecule OS=Gallus gallus OX=9031 PE=1 SV=2
14	Q05695	0.0	869	1259	0.383	0.397	L1CAM_RAT Neural cell adhesion molecule L1 OS=Rattus norvegicus OX=10116 GN=L1cam PE=1 SV=3
15	Q810U3	0.0	897	1240	0.349	0.367	NFASC_MOUSE Neurofascin OS=Mus musculus OX=10090 GN=Nfasc PE=1 SV=1
16	Q810U4	0.0	2404	1256	0.900	0.934	NRCAM_MOUSE Neuronal cell adhesion molecule OS=Mus musculus OX=10090 GN=Nrcam PE=1 SV=2
17	Q90478	0.0	710	1197	0.351	0.383	L1CA1_DANRE Neural cell adhesion molecule L1.1 (Fragment) OS=Danio rerio OX=7955 GN=nadl1.1 PE=2 SV=1
18	Q90933	0.0	760	1280	0.364	0.371	Q90933_CHICK Neuron-glia cell adhesion molecule (Ng-CAM) OS=Gallus gallus OX=9031 PE=2 SV=1
19	Q92823	0.0	2695	1304	1.000	1.000	NRCAM_HUMAN Neuronal cell adhesion molecule OS=Homo sapiens OX=9606 GN=NRCAM PE=1 SV=3
20	P20241	6.00e-180	569	1302	0.321	0.321	NRG_DROME Neuroglian OS=Drosophila melanogaster OX=7227 GN=Nrg PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02440 Adeno_E3_CR1	2.2e+02	13.0	Adenovirus E3 region protein CR1
2	PF13882 Bravo_FIGEY	1e-22	92.4	Bravo-like intracellular region
3	PF08205 C2-set_2	1.1e-05	36.7	CD80-like C2-set immunoglobulin domain
4	PF00041 fn3	3e-63	221.5	Fibronectin type III domain
5	PF16893 fn3_2	7	18.2	Fibronectin type III domain
6	PF07679 I-set	2.6e-68	237.4	Immunoglobulin I-set domain
7	PF00047 ig	2.6e-42	154.2	Immunoglobulin domain
8	PF13895 Ig_2	6.1e-46	166.0	Immunoglobulin domain
9	PF13927 Ig_3	9.3e-71	245.7	Immunoglobulin domain
10	PF16680 Ig_4	0.0019	30.1	T-cell surface glycoprotein CD3 delta chain
11	PF16681 Ig_5	1.5e-06	39.9	Ig-like domain on T-cell surface glycoprotein CD3 epsilon chain
12	PF17736 Ig_C17orf99	2.1e-06	39.0	C17orf99 Ig domain
13	PF15142 INCA1	4.8e+02	12.1	INCA1
14	PF09294 Interfer-bind	57	15.4	Interferon-alpha/beta receptor, fibronectin type III
15	PF16706 Izumo-Ig	32	15.9	Izumo-like Immunoglobulin domain
16	PF16656 Pur_ac_phosph_N	0.00023	33.1	Purple acid Phosphatase, N-terminal domain
17	PF15330 SIT	44	16.0	SHP2-interacting transmembrane adaptor protein, SIT
18	PF07686 V-set	3.2e-06	38.7	Immunoglobulin V-set domain
19	PF08204 V-set_CD47	0.3	22.5	CD47 immunoglobulin-like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000368314

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000280772	0.995	Ankyrin-3
2	9606.ENSP00000335196	0.985	Gliomedin
3	9606.ENSP00000353582	0.983	Neuropilin-2
4	9606.ENSP00000349588	0.941	Ankyrin-2
5	9606.ENSP00000330633	0.913	Contactin-2
6	9606.ENSP00000324857	0.912	Semaphorin-6D
7	9606.ENSP00000263373	0.900	Spectrin beta chain, non-erythrocytic 4
8	9606.ENSP00000447006	0.891	Contactin-1
9	9606.ENSP00000377061	0.890	Plexin-A1
10	9606.ENSP00000265709	0.885	Ankyrin-1
11	9606.ENSP00000377047	0.878	Receptor-type tyrosine-protein phosphatase zeta
12	9606.ENSP00000344786	0.872	Neurofascin
13	9606.ENSP00000346671	0.871	Tyrosine-protein kinase Fyn
14	9606.ENSP00000346534	0.841	Sodium channel protein type 8 subunit alpha
15	9606.ENSP00000382428	0.833	Disks large homolog 4
16	9606.ENSP00000352035	0.826	Potassium voltage-gated channel subfamily KQT member 2
17	9606.ENSP00000363480	0.826	Disks large homolog 3
18	9606.ENSP00000364586	0.814	Sodium channel protein type 2 subunit alpha
19	9606.ENSP00000354778	0.771	Contactin-associated protein-like 2
20	9606.ENSP00000303540	0.767	Sodium channel protein type 1 subunit alpha

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0030506	1.000	ankyrin binding
GO:0050839	0.659	cell adhesion molecule binding
GO:0019899	0.402	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032501	0.995	multicellular organismal process
GO:0009987	0.995	cellular process
GO:0048856	0.946	anatomical structure development
GO:0007275	0.935	multicellular organism development
GO:0007399	0.912	nervous system development
GO:0071840	0.906	cellular component organization or biogenesis
GO:0016043	0.902	cellular component organization
GO:0030154	0.865	cell differentiation
GO:0007155	0.806	cell adhesion
GO:0050896	0.699	response to stimulus
GO:0065007	0.628	biological regulation
GO:0050789	0.599	regulation of biological process
GO:0048699	0.577	generation of neurons
GO:0050794	0.569	regulation of cellular process
GO:0030182	0.545	neuron differentiation
GO:0048468	0.413	cell development
GO:0030030	0.382	cell projection organization
GO:0120036	0.373	plasma membrane bounded cell projection organization
GO:0009653	0.368	anatomical structure morphogenesis
GO:0007154	0.358	cell communication
GO:0031175	0.339	neuron projection development
GO:0051716	0.306	cellular response to stimulus
GO:0061564	0.306	axon development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0043226	0.734	organelle
GO:0043227	0.691	membrane-bounded organelle
GO:0005622	0.620	intracellular anatomical structure
GO:0042995	0.582	cell projection
GO:0043005	0.566	neuron projection
GO:0043229	0.468	intracellular organelle
GO:0030424	0.441	axon
GO:0030054	0.380	cell junction
GO:0005737	0.336	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]