StarFunc result for job id Q92824

User Input

>input (1860 residues)
MGWGSRCCCPGRLDLLCVLALLGGCLLPVCRTRVYTNHWAVKIAGGFPEANRIASKYGFI
NIGQIGALKDYYHFYHSRTIKRSVISSRGTHSFISMEPKVEWIQQQVVKKRTKRDYDFSR
AQSTYFNDPKWPSMWYMHCSDNTHPCQSDMNIEGAWKRGYTGKNIVVTILDDGIERTHPD
LMQNYDALASCDVNGNDLDPMPRYDASNENKHGTRCAGEVAAAANNSHCTVGIAFNAKIG
GVRMLDGDVTDMVEAKSVSFNPQHVHIYSASWGPDDDGKTVDGPAPLTRQAFENGVRMGR
RGLGSVFVWASGNGGRSKDHCSCDGYTNSIYTISISSTAESGKKPWYLEECSSTLATTYS
SGESYDKKIITTDLRQRCTDNHTGTSASAPMAAGIIALALEANPFLTWRDVQHVIVRTSR
AGHLNANDWKTNAAGFKVSHLYGFGLMDAEAMVMEAEKWTTVPRQHVCVESTDRQIKTIR
PNSAVRSIYKASGCSDNPNRHVNYLEHVVVRITITHPRRGDLAIYLTSPSGTRSQLLANR
LFDHSMEGFKNWEFMTIHCWGERAAGDWVLEVYDTPSQLRNFKTPGKLKEWSLVLYGTSV
QPYSPTNEFPKVERFRYSRVEDPTDDYGTEDYAGPCDPECSEVGCDGPGPDHCNDCLHYY
YKLKNNTRICVSSCPPGHYHADKKRCRKCAPNCESCFGSHGDQCMSCKYGYFLNEETNSC
VTHCPDGSYQDTKKNLCRKCSENCKTCTEFHNCTECRDGLSLQGSRCSVSCEDGRYFNGQ
DCQPCHRFCATCAGAGADGCINCTEGYFMEDGRCVQSCSISYYFDHSSENGYKSCKKCDI
SCLTCNGPGFKNCTSCPSGYLLDLGMCQMGAICKDGEYVDEHGHCQTCEASCAKCQGPTQ
EDCTTCPMTRIFDDGRCVSNCPSWKFEFENQCHPCHHTCQRCQGSGPTHCTSCGADNYGR
EHFLYQGECGDSCPEGHYATEGNTCLPCPDNCELCHSVHVCTRCMKGYFIAPTNHTCQKL
ECGQGEVQDPDYEECVPCEEGCLGCSLDDPGTCTSCAMGYYRFDHHCYKTCPEKTYSEEV
ECKACDSNCGSCDQNGCYWCEEGFFLLGGSCVRKCGPGFYGDQEMGECESCHRACETCTG
PGHDECSSCQEGLQLLRGMCVHATKTQEEGKFWNDILRKLQPCHSSCKTCNGSATLCTSC
PKGAYLLAQACVSSCPQGTWPSVRSGSCENCTEACAICSGADLCKKCQMQPGHPLFLHEG
RCYSKCPEGSYAEDGICERCSSPCRTCEGNATNCHSCEGGHVLHHGVCQENCPERHVAVK
GVCKHCPEMCQDCIHEKTCKECTPEFFLHDDMCHQSCPRGFYADSRHCVPCHKDCLECSG
PKADDCELCLESSWVLYDGLCLEECPAGTYYEKETKECRDCHKSCLTCSSSGTCTTCQKG
LIMNPRGSCMANEKCSPSEYWDEDAPGCKPCHVKCFHCMGPAEDQCQTCPMNSLLLNTTC
VKDCPEGYYADEDSNRCAHCHSSCRTCEGRHSRQCHSCRPGWFQLGKECLLQCREGYYAD
NSTGRCERCNRSCKGCQGPRPTDCLSCDRFFFLLRSKGECHRSCPDHYYVEQSTQTCERC
HPTCDQCKGKGALNCLSCVWSYHLMGGICTSDCLVGEYRVGEGEKFNCEKCHESCMECKG
PGAKNCTLCPANLVLHMDDSHCLHCCNTSDPPSAQECCDCQDTTDECILRTSKVRPATEH
FKTALFITSSMMLVLLLGAAVVVWKKSRGRVQPAAKAGYEKLADPNKSYSSYKSSYREST
SFEEDQVIEYRDRDYDEDDDDDIVYMGQDGTVYRKFKYGLLDDDDIDELEYDDESYSYYQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A2BHH6	0.257	0.262	0.000	1821	0.503	0.514	A2BHH6.pdb.gz
2	AFDB:P29122	0.266	0.507	0.000	969	0.270	0.519	P29122.pdb.gz	PCSK6_HUMAN Proprotein convertase subtilisin/kexin type 6 OS=Homo sapiens OX=9606 GN=PCSK6 PE=1 SV=1
3	AFDB:P41413	0.264	0.271	0.000	1809	0.789	0.811	P41413.pdb.gz	PCSK5_RAT Proprotein convertase subtilisin/kexin type 5 OS=Rattus norvegicus OX=10116 GN=Pcsk5 PE=2 SV=3
4	AFDB:Q04592	0.319	0.317	0.000	1877	0.814	0.807	Q04592.pdb.gz	PCSK5_MOUSE Proprotein convertase subtilisin/kexin type 5 OS=Mus musculus OX=10090 GN=Pcsk5 PE=1 SV=3
5	AFDB:Q92824	1.000	1.000	0.000	1860	1.000	1.000	Q92824.pdb.gz	PCSK5_HUMAN Proprotein convertase subtilisin/kexin type 5 OS=Homo sapiens OX=9606 GN=PCSK5 PE=1 SV=4
6	AFDB:P30432	0.252	0.279	3.039E-102	1679	0.286	0.317	P30432.pdb.gz	FUR2_DROME Furin-like protease 2 OS=Drosophila melanogaster OX=7227 GN=Fur2 PE=2 SV=2
7	AFDB:H3BJL4	0.155	0.358	7.542E-83	798	0.232	0.541	H3BJL4.pdb.gz	H3BJL4_MOUSE Proprotein convertase subtilisin/kexin type 6 (Fragment) OS=Mus musculus OX=10090 GN=Pcsk6 PE=1 SV=1
8	AFDB:F1QQ43	0.254	0.577	2.695E-77	806	0.192	0.444	F1QQ43.pdb.gz	F1QQ43_DANRE Furin (paired basic amino acid cleaving enzyme) a OS=Danio rerio OX=7955 GN=furin PE=3 SV=3
9	AFDB:P09958	0.257	0.587	9.681E-77	794	0.192	0.451	P09958.pdb.gz	FURIN_HUMAN Furin OS=Homo sapiens OX=9606 GN=FURIN PE=1 SV=2
10	AFDB:F1QKU2	0.253	0.564	1.191E-75	823	0.188	0.425	F1QKU2.pdb.gz	F1QKU2_DANRE Furin (paired basic amino acid cleaving enzyme) b OS=Danio rerio OX=7955 GN=furinb PE=3 SV=1
11	PDB:1r6vA	0.147	0.380	2.959E-13	671	0.049	0.136	1r6vA.pdb.gz	Crystal structure of fervidolysin from Fervidobacterium pennivorans, a keratinolytic enzyme related to subtilisin.
12	PDB:2x8jD	0.131	0.726	3.372E-11	308	0.031	0.188	2x8jD.pdb.gz
13	PDB:3wivC	0.137	0.592	2.039E-10	397	0.041	0.191	3wivC.pdb.gz	Requirement of the insertion sequence for activation of Tk-subtilisin
14	PDB:6u3xB	0.130	0.437	1.591E-8	486	0.039	0.150	6u3xB.pdb.gz	From Screening to Targeted Degradation: Strategies for the Discovery and Optimization of Small Molecule Ligands for PCSK9.
15	PDB:3lxuX	0.099	0.145	2.525E-6	1217	0.032	0.048	3lxuX.pdb.gz
16	PDB:7mn8B	0.054	0.124	4.128E-5	579	0.042	0.135	7mn8B.pdb.gz
17	PDB:3edyA	0.115	0.345	6.029E-5	544	0.031	0.105	3edyA.pdb.gz	Crystal Structure and Autoactivation Pathway of the Precursor Form of Human Tripeptidyl-peptidase 1, the Enzyme Deficient in Late Infantile Ceroid Lipofuscinosis
18	PDB:6pxvA	0.042	0.081	3.712E-3	823	0.020	0.046	6pxvA.pdb.gz
19	PDB:4kncB	0.045	0.162	5.422E-3	419	0.010	0.043	4kncB.pdb.gz
20	PDB:2waaA	0.046	0.198	5.960E-3	335	0.008	0.045	2waaA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A669KA35	3823	1887	1.000	0.986	A0A669KA35_HUMAN Proprotein convertase subtilisin/kexin type 5 OS=Homo sapiens OX=9606 GN=PCSK5 PE=1 SV=1
2	E9Q4D0	1030	946	0.268	0.527	E9Q4D0_MOUSE Proprotein convertase subtilisin/kexin type 6 OS=Mus musculus OX=10090 GN=Pcsk6 PE=1 SV=2
3	F1QKU2	672	823	0.191	0.433	F1QKU2_DANRE Furin (paired basic amino acid cleaving enzyme) b OS=Danio rerio OX=7955 GN=furinb PE=3 SV=1
4	F1QQ43	650	806	0.174	0.401	F1QQ43_DANRE Furin (paired basic amino acid cleaving enzyme) a OS=Danio rerio OX=7955 GN=furin PE=3 SV=3
5	F6XJP7	1023	959	0.268	0.520	F6XJP7_MOUSE Proprotein convertase subtilisin/kexin type 6 OS=Mus musculus OX=10090 GN=Pcsk6 PE=1 SV=1
6	H3BJL4	696	798	0.208	0.484	H3BJL4_MOUSE Proprotein convertase subtilisin/kexin type 6 (Fragment) OS=Mus musculus OX=10090 GN=Pcsk6 PE=1 SV=1
7	O17798	625	692	0.176	0.473	FKPC1_CAEEL Furin-like protease kpc-1 OS=Caenorhabditis elegans OX=6239 GN=kpc-1 PE=1 SV=3
8	P09958	671	794	0.181	0.423	FURIN_HUMAN Furin OS=Homo sapiens OX=9606 GN=FURIN PE=1 SV=2
9	P23188	660	793	0.176	0.414	FURIN_MOUSE Furin OS=Mus musculus OX=10090 GN=Furin PE=1 SV=2
10	P23377	657	793	0.176	0.414	FURIN_RAT Furin OS=Rattus norvegicus OX=10116 GN=Furin PE=1 SV=1
11	P26016	585	1269	0.161	0.236	FUR11_DROME Furin-like protease 1, isoforms 1/1-X/2 OS=Drosophila melanogaster OX=7227 GN=Fur1 PE=2 SV=2
12	P28840	577	752	0.160	0.395	NEC1_RAT Neuroendocrine convertase 1 OS=Rattus norvegicus OX=10116 GN=Pcsk1 PE=2 SV=1
13	P29120	573	753	0.155	0.382	NEC1_HUMAN Neuroendocrine convertase 1 OS=Homo sapiens OX=9606 GN=PCSK1 PE=1 SV=2
14	P29121	576	655	0.148	0.421	PCSK4_MOUSE Proprotein convertase subtilisin/kexin type 4 OS=Mus musculus OX=10090 GN=Pcsk4 PE=2 SV=1
15	P29122	1014	969	0.267	0.512	PCSK6_HUMAN Proprotein convertase subtilisin/kexin type 6 OS=Homo sapiens OX=9606 GN=PCSK6 PE=1 SV=1
16	P30432	697	1679	0.253	0.280	FUR2_DROME Furin-like protease 2 OS=Drosophila melanogaster OX=7227 GN=Fur2 PE=2 SV=2
17	P41413	2413	1809	0.694	0.714	PCSK5_RAT Proprotein convertase subtilisin/kexin type 5 OS=Rattus norvegicus OX=10116 GN=Pcsk5 PE=2 SV=3
18	P63239	575	753	0.159	0.392	NEC1_MOUSE Neuroendocrine convertase 1 OS=Mus musculus OX=10090 GN=Pcsk1 PE=1 SV=1
19	Q04592	3025	1877	0.811	0.804	PCSK5_MOUSE Proprotein convertase subtilisin/kexin type 5 OS=Mus musculus OX=10090 GN=Pcsk5 PE=1 SV=3
20	Q1KHF9	650	806	0.174	0.401	Q1KHF9_DANRE Furin (Paired basic amino acid cleaving enzyme) a OS=Danio rerio OX=7955 GN=furinA PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00757 Furin-like	0.004	28.5	Furin-like cysteine rich region
2	PF15913 Furin-like_2	9.2e-28	107.8	Furin-like repeat, cysteine-rich
3	PF14843 GF_recep_IV	3.3e-31	119.2	Growth factor receptor domain IV
4	PF00082 Peptidase_S8	1.7e-43	160.5	Subtilase family
5	PF01483 P_proprotein	6.4e-28	107.9	Proprotein convertase P-domain
6	PF16470 S8_pro-domain	1.1e-21	88.5	Peptidase S8 pro-domain
7	PF03302 VSP	2.2e-17	74.7	Giardia variant-specific surface protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000446280

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000358525	0.941	Beta-nerve growth factor
2	9606.ENSP00000252252	0.921	Keratin, type II cytoskeletal 6B
3	9606.ENSP00000309757	0.907	Lipoprotein lipase
4	9606.ENSP00000480053	0.905	Glycosylphosphatidylinositol-anchored high density lipoprotein-binding protein 1
5	9606.ENSP00000383923	0.876	Lipase member N
6	9606.ENSP00000480132	0.794	Neural cell adhesion molecule 1
7	9606.ENSP00000411355	0.787	Receptor-type tyrosine-protein phosphatase C
8	9606.ENSP00000438209	0.758	Transcription factor Sp6
9	9606.ENSP00000303208	0.732	Proprotein convertase subtilisin/kexin type 9
10	9606.ENSP00000257868	0.696	Growth/differentiation factor 11
11	9606.ENSP00000294304	0.673	Low-density lipoprotein receptor-related protein 5
12	9606.ENSP00000344223	0.666	Membrane-bound transcription factor site-1 protease
13	9606.ENSP00000434279	0.642	Transmembrane protease serine 13
14	9606.ENSP00000351536	0.624	Sulfhydryl oxidase 2
15	9606.ENSP00000477949	0.622	Transmembrane protease serine 4
16	9606.ENSP00000011653	0.619	T-cell surface glycoprotein CD4
17	9606.ENSP00000437940	0.618	B-lymphocyte antigen CD19
18	9606.ENSP00000386559	0.603	T-cell surface glycoprotein CD8 alpha chain
19	9606.ENSP00000432816	0.594	Acrosomal vesicle protein 1
20	9606.ENSP00000378418	0.581	Transcription factor Sp9

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004252	1.000	serine-type endopeptidase activity
GO:0042277	0.311	peptide binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.990	biological regulation
GO:0009987	0.980	cellular process
GO:0032501	0.935	multicellular organismal process
GO:0071704	0.925	organic substance metabolic process
GO:0048856	0.914	anatomical structure development
GO:0044238	0.891	primary metabolic process
GO:0050789	0.877	regulation of biological process
GO:0043170	0.838	macromolecule metabolic process
GO:0006807	0.836	nitrogen compound metabolic process
GO:0050794	0.831	regulation of cellular process
GO:0007275	0.811	multicellular organism development
GO:0065008	0.800	regulation of biological quality
GO:1901564	0.720	organonitrogen compound metabolic process
GO:0019538	0.699	protein metabolic process
GO:0050896	0.696	response to stimulus
GO:0016485	0.663	protein processing
GO:0140448	0.636	signaling receptor ligand precursor processing
GO:0016486	0.619	peptide hormone processing
GO:0048518	0.613	positive regulation of biological process
GO:0048731	0.482	system development
GO:0044237	0.424	cellular metabolic process
GO:0007154	0.418	cell communication
GO:0048522	0.417	positive regulation of cellular process
GO:0023052	0.366	signaling

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0012505	0.999	endomembrane system
GO:0005737	0.999	cytoplasm
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0070013	0.995	intracellular organelle lumen
GO:0005794	0.990	Golgi apparatus
GO:0005576	0.980	extracellular region
GO:0016020	0.824	membrane
GO:0005615	0.485	extracellular space
GO:0071944	0.385	cell periphery

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.21.-	1.000	Serine endopeptidases.

[back to server]