StarFunc result for job id Q92830

User Input

>input (837 residues)
MAEPSQAPTPAPAAQPRPLQSPAPAPTPTPAPSPASAPIPTPTPAPAPAPAAAPAGSTGT
GGPGVGSGGAGSGGDPARPGLSQQQRASQRKAQVRGLPRAKKLEKLGVFSACKANETCKC
NGWKNPKPPTAPRMDLQQPAANLSELCRSCEHPLADHVSHLENVSEDEINRLLGMVVDVE
NLFMSVHKEEDTDTKQVYFYLFKLLRKCILQMTRPVVEGSLGSPPFEKPNIEQGVLNFVQ
YKFSHLAPRERQTMFELSKMFLLCLNYWKLETPAQFRQRSQAEDVATYKVNYTRWLCYCH
VPQSCDSLPRYETTHVFGRSLLRSIFTVTRRQLLEKFRVEKDKLVPEKRTLILTHFPKFL
SMLEEEIYGANSPIWESGFTMPPSEGTQLVPRPASVSAAVVPSTPIFSPSMGGGSNSSLS
LDSAGAEPMPGEKRTLPENLTLEDAKRLRVMGDIPMELVNEVMLTITDPAAMLGPETSLL
SANAARDETARLEERRGIIEFHVIGNSLTPKANRRVLLWLVGLQNVFSHQLPRMPKEYIA
RLVFDPKHKTLALIKDGRVIGGICFRMFPTQGFTEIVFCAVTSNEQVKGYGTHLMNHLKE
YHIKHNILYFLTYADEYAIGYFKKQGFSKDIKVPKSRYLGYIKDYEGATLMECELNPRIP
YTELSHIIKKQKEIIKKLIERKQAQIRKVYPGLSCFKEGVRQIPVESVPGIRETGWKPLG
KEKGKELKDPDQLYTTLKNLLAQIKSHPSAWPFMEPVKKSEAPDYYEVIRFPIDLKTMTE
RLRSRYYVTRKLFVADLQRVIANCREYNPPDSEYCRCASALEKFFYFKLKEGGLIDK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0R4IXF6	0.768	0.805	0.000	795	0.799	0.842	A0A0R4IXF6.pdb.gz	KAT2A_DANRE Histone acetyltransferase KAT2A OS=Danio rerio OX=7955 GN=kat2a PE=2 SV=1
2	AFDB:Q92830	1.000	1.000	0.000	837	1.000	1.000	Q92830.pdb.gz	KAT2A_HUMAN Histone acetyltransferase KAT2A OS=Homo sapiens OX=9606 GN=KAT2A PE=1 SV=3
3	AFDB:Q92831	0.582	0.584	1.350E-93	832	0.704	0.708	Q92831.pdb.gz	KAT2B_HUMAN Histone acetyltransferase KAT2B OS=Homo sapiens OX=9606 GN=KAT2B PE=1 SV=3
4	AFDB:Q1LUC3	0.604	0.631	2.853E-93	796	0.691	0.726	Q1LUC3.pdb.gz	KAT2B_DANRE Histone acetyltransferase KAT2B OS=Danio rerio OX=7955 GN=kat2b PE=2 SV=1
5	AFDB:O76216	0.345	0.355	9.316E-74	813	0.447	0.460	O76216.pdb.gz	O76216_DROME histone acetyltransferase OS=Drosophila melanogaster OX=7227 GN=Gcn5 PE=1 SV=1
6	AFDB:Q9UUK2	0.254	0.429	3.993E-33	454	0.208	0.383	Q9UUK2.pdb.gz	GCN5_SCHPO Histone acetyltransferase gcn5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gcn5 PE=1 SV=1
7	AFDB:Q9AR19	0.253	0.362	5.540E-33	568	0.205	0.303	Q9AR19.pdb.gz	GCN5_ARATH Histone acetyltransferase GCN5 OS=Arabidopsis thaliana OX=3702 GN=HAG1 PE=1 SV=1
8	AFDB:Q03330	0.245	0.443	1.624E-32	439	0.208	0.396	Q03330.pdb.gz	GCN5_YEAST Histone acetyltransferase GCN5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GCN5 PE=1 SV=1
9	AFDB:Q8IB67	0.267	0.166	3.125E-32	1465	0.229	0.131	Q8IB67.pdb.gz	Q8IB67_PLAF7 Histone acetyltransferase GCN5 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0823300 PE=1 SV=2
10	AFDB:Q338B9	0.247	0.391	8.341E-32	511	0.219	0.358	Q338B9.pdb.gz	GCN5_ORYSJ Histone acetyltransferase GCN5 OS=Oryza sativa subsp. japonica OX=39947 GN=GCN5 PE=1 SV=1
11	PDB:4ua3B	0.166	0.656	1.111E-5	194	0.018	0.077	4ua3B.pdb.gz	The Molecular Basis for Histone H4- and H2A-Specific Amino-Terminal Acetylation by NatD.
12	PDB:1tiqA	0.144	0.604	1.614E-5	173	0.038	0.185	1tiqA.pdb.gz	Structural and functional evidence for Bacillus subtilis PaiA as a novel N1-spermidine/spermine acetyltransferase.
13	PDB:3fixA	0.127	0.548	2.700E-5	165	0.030	0.152	3fixA.pdb.gz
14	PDB:5isvA	0.143	0.678	3.574E-5	156	0.029	0.154	5isvA.pdb.gz
15	PDB:5jq4B	0.148	0.739	5.978E-5	146	0.026	0.151	5jq4B.pdb.gz
16	PDB:2ob0C	0.135	0.552	2.431E-4	166	0.038	0.193	2ob0C.pdb.gz	Structure of Human MAK3 homolog
17	PDB:2wpwA	0.135	0.322	3.372E-4	328	0.029	0.073	2wpwA.pdb.gz	Crystallographic and mass spectrometric analyses of a tandem GNAT protein from the clavulanic acid biosynthesis pathway.
18	PDB:3owcA	0.118	0.497	3.703E-4	172	0.026	0.128	3owcA.pdb.gz	Crystal structure of GNAT superfamily protein PA2578 from Pseudomonas aeruginosa
19	PDB:4avaA	0.120	0.281	5.136E-4	327	0.026	0.067	4avaA.pdb.gz	Cyclic AMP Regulation of Protein Lysine Acetylation in Mycobacterium Tuberculosis.
20	PDB:6z00A	0.139	0.624	5.136E-4	156	0.036	0.192	6z00A.pdb.gz	Structural and functional characterization of the N-terminal acetyltransferase Naa50.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0R4IXF6	0.0	1391	795	0.803	0.845	KAT2A_DANRE Histone acetyltransferase KAT2A OS=Danio rerio OX=7955 GN=kat2a PE=2 SV=1
2	A0A8I5Y222	0.0	1144	813	0.683	0.704	A0A8I5Y222_RAT Histone acetyltransferase OS=Rattus norvegicus OX=10116 GN=Kat2b PE=3 SV=1
3	A0A8J8YC15	0.0	1066	765	0.637	0.697	A0A8J8YC15_RAT Histone acetyltransferase OS=Rattus norvegicus OX=10116 GN=Kat2b PE=3 SV=1
4	D4ACX5	0.0	1690	833	0.980	0.984	D4ACX5_RAT Histone acetyltransferase OS=Rattus norvegicus OX=10116 GN=Kat2a PE=3 SV=3
5	O76216	0.0	729	813	0.435	0.448	O76216_DROME histone acetyltransferase OS=Drosophila melanogaster OX=7227 GN=Gcn5 PE=1 SV=1
6	Q1LUC3	0.0	1118	796	0.683	0.719	KAT2B_DANRE Histone acetyltransferase KAT2B OS=Danio rerio OX=7955 GN=kat2b PE=2 SV=1
7	Q92830	0.0	1732	837	1.000	1.000	KAT2A_HUMAN Histone acetyltransferase KAT2A OS=Homo sapiens OX=9606 GN=KAT2A PE=1 SV=3
8	Q92831	0.0	1149	832	0.677	0.681	KAT2B_HUMAN Histone acetyltransferase KAT2B OS=Homo sapiens OX=9606 GN=KAT2B PE=1 SV=3
9	Q9JHD1	0.0	1149	813	0.693	0.713	KAT2B_MOUSE Histone acetyltransferase KAT2B OS=Mus musculus OX=10090 GN=Kat2b PE=1 SV=2
10	Q9JHD2	0.0	1674	830	0.973	0.981	KAT2A_MOUSE Histone acetyltransferase KAT2A OS=Mus musculus OX=10090 GN=Kat2a PE=1 SV=2
11	Q9VTZ1	0.0	729	813	0.436	0.449	Q9VTZ1_DROME histone acetyltransferase OS=Drosophila melanogaster OX=7227 GN=Gcn5 PE=2 SV=1
12	Q9UUK2	3.86e-106	336	454	0.197	0.363	GCN5_SCHPO Histone acetyltransferase gcn5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gcn5 PE=1 SV=1
13	Q338B9	1.41e-104	334	511	0.197	0.323	GCN5_ORYSJ Histone acetyltransferase GCN5 OS=Oryza sativa subsp. japonica OX=39947 GN=GCN5 PE=1 SV=1
14	Q9AR19	7.38e-98	318	568	0.188	0.276	GCN5_ARATH Histone acetyltransferase GCN5 OS=Arabidopsis thaliana OX=3702 GN=HAG1 PE=1 SV=1
15	Q03330	9.28e-96	308	439	0.191	0.364	GCN5_YEAST Histone acetyltransferase GCN5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GCN5 PE=1 SV=1
16	Q59PZ5	1.53e-93	303	449	0.191	0.356	Q59PZ5_CANAL Histone acetyltransferase GCN5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=GCN5 PE=3 SV=1
17	Q8IB67	2.22e-88	308	1465	0.192	0.110	Q8IB67_PLAF7 Histone acetyltransferase GCN5 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0823300 PE=1 SV=2
18	Q568Z2	1.85e-39	142	84	0.075	0.750	Q568Z2_RAT p300/CBP-associated factor OS=Rattus norvegicus OX=10116 GN=Pcaf PE=2 SV=1
19	B1H2A3	6.53e-25	108	326	0.060	0.153	B1H2A3_RAT Falz protein OS=Rattus norvegicus OX=10116 GN=Falz PE=2 SV=1
20	E7F366	9.89e-25	114	2899	0.060	0.017	E7F366_DANRE Bromodomain PHD finger transcription factor OS=Danio rerio OX=7955 GN=bptf PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00583 Acetyltransf_1	1.4e-06	40.0	Acetyltransferase (GNAT) family
2	PF13673 Acetyltransf_10	0.055	24.9	Acetyltransferase (GNAT) domain
3	PF13508 Acetyltransf_7	0.078	24.6	Acetyltransferase (GNAT) domain
4	PF00439 Bromodomain	5.6e-19	79.3	Bromodomain
5	PF18232 Chalcone_N	1.9e+02	13.9	Chalcone isomerase N-terminal domain
6	PF06466 PCAF_N	1e-113	390.6	PCAF (P300/CBP-associated factor) N-terminal domain
7	PF04612 T2SSM	3.6e+02	12.7	Type II secretion system (T2SS), protein M

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000225916

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000307684	0.999	Transcriptional adapter 3
2	9606.ENSP00000316114	0.999	SAGA-associated factor 29
3	9606.ENSP00000352925	0.999	Transformation/transcription domain-associated protein
4	9606.ENSP00000360515	0.999	Transcription initiation protein SPT3 homolog
5	9606.ENSP00000479618	0.999	Myc proto-oncogene protein
6	9606.ENSP00000481091	0.999	Transcriptional adapter 2-alpha
7	9606.ENSP00000261497	0.998	Ubiquitin carboxyl-terminal hydrolase 22
8	9606.ENSP00000308022	0.998	Transcriptional adapter 2-beta
9	9606.ENSP00000439585	0.998	Ataxin-7
10	9606.ENSP00000299424	0.997	Transcription initiation factor TFIID subunit 10
11	9606.ENSP00000397259	0.997	Ataxin-7-like protein 3
12	9606.ENSP00000417510	0.997	SPT20 homolog, SAGA complex component
13	9606.ENSP00000258281	0.995	TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L
14	9606.ENSP00000351446	0.995	WD repeat-containing protein 5
15	9606.ENSP00000370193	0.994	Transcription initiation factor TFIID subunit 9
16	9606.ENSP00000399982	0.992	Transcription initiation factor TFIID subunit 6
17	9606.ENSP00000263974	0.990	Transcription initiation factor TFIID subunit 12
18	9606.ENSP00000340330	0.990	Histone acetyltransferase KAT5
19	9606.ENSP00000339917	0.989	Transcription initiation factor TFIID subunit 9B
20	9606.ENSP00000358854	0.989	Transcription initiation factor TFIID subunit 5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003682	1.000	chromatin binding
GO:0019899	1.000	enzyme binding
GO:0140297	1.000	DNA-binding transcription factor binding
GO:0010484	0.999	histone H3 acetyltransferase activity
GO:0003712	0.987	transcription coregulator activity
GO:0003713	0.979	transcription coactivator activity
GO:0042826	0.888	histone deacetylase binding
GO:0043992	0.485	histone H3K9 acetyltransferase activity
GO:0097159	0.308	organic cyclic compound binding
GO:1901363	0.306	heterocyclic compound binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.998	regulation of biological process
GO:0008152	0.995	metabolic process
GO:0048518	0.994	positive regulation of biological process
GO:0031323	0.991	regulation of cellular metabolic process
GO:0009987	0.985	cellular process
GO:0044238	0.980	primary metabolic process
GO:0071704	0.979	organic substance metabolic process
GO:0006807	0.972	nitrogen compound metabolic process
GO:0010468	0.966	regulation of gene expression
GO:0019219	0.965	regulation of nucleobase-containing compound metabolic process
GO:0009889	0.950	regulation of biosynthetic process
GO:0043170	0.947	macromolecule metabolic process
GO:0031326	0.937	regulation of cellular biosynthetic process
GO:0010604	0.904	positive regulation of macromolecule metabolic process
GO:0048522	0.899	positive regulation of cellular process
GO:0010556	0.896	regulation of macromolecule biosynthetic process
GO:0006355	0.886	regulation of DNA-templated transcription
GO:0051173	0.849	positive regulation of nitrogen compound metabolic process
GO:0031325	0.772	positive regulation of cellular metabolic process
GO:0036211	0.728	protein modification process
GO:0006357	0.722	regulation of transcription by RNA polymerase II
GO:0045893	0.716	positive regulation of DNA-templated transcription
GO:0045944	0.689	positive regulation of transcription by RNA polymerase II
GO:0018205	0.685	peptidyl-lysine modification
GO:0043543	0.579	protein acylation
GO:0006473	0.565	protein acetylation
GO:0071840	0.555	cellular component organization or biogenesis
GO:0050896	0.548	response to stimulus
GO:0016043	0.514	cellular component organization
GO:0016570	0.509	histone modification
GO:0018394	0.485	peptidyl-lysine acetylation
GO:0048519	0.479	negative regulation of biological process
GO:0048523	0.469	negative regulation of cellular process
GO:0018393	0.457	internal peptidyl-lysine acetylation
GO:0050793	0.426	regulation of developmental process
GO:0051716	0.415	cellular response to stimulus
GO:0051246	0.406	regulation of protein metabolic process
GO:0031399	0.372	regulation of protein modification process
GO:0051239	0.350	regulation of multicellular organismal process
GO:0006338	0.350	chromatin remodeling
GO:0032501	0.349	multicellular organismal process
GO:0009892	0.338	negative regulation of metabolic process
GO:0016573	0.309	histone acetylation
GO:0051726	0.304	regulation of cell cycle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0000785	0.999	chromatin
GO:1990234	0.998	transferase complex
GO:0005654	0.998	nucleoplasm
GO:0140535	0.997	intracellular protein-containing complex
GO:0000123	0.993	histone acetyltransferase complex
GO:0140672	0.980	ATAC complex
GO:0005737	0.955	cytoplasm
GO:0005856	0.891	cytoskeleton
GO:0015630	0.698	microtubule cytoskeleton
GO:0000124	0.520	SAGA complex
GO:0140513	0.430	nuclear protein-containing complex
GO:0005829	0.379	cytosol
GO:0033276	0.351	transcription factor TFTC complex
GO:0005615	0.350	extracellular space

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:21992	1.000	acetyl-CoA + L-lysyl-[histone] = CoA + H(+) + N(6)-acetyl-L-lysyl-[histone]
EC:2.3.1.48	1.000	histone acetyltransferase.

[back to server]