StarFunc result for job id Q92831

User Input

>input (832 residues)
MSEAGGAGPGGCGAGAGAGAGPGALPPQPAALPPAPPQGSPCAAAAGGSGACGPATAVAA
AGTAEGPGGGGSARIAVKKAQLRSAPRAKKLEKLGVYSACKAEESCKCNGWKNPNPSPTP
PRADLQQIIVSLTESCRSCSHALAAHVSHLENVSEEEMNRLLGIVLDVEYLFTCVHKEED
ADTKQVYFYLFKLLRKSILQRGKPVVEGSLEKKPPFEKPSIEQGVNNFVQYKFSHLPAKE
RQTIVELAKMFLNRINYWHLEAPSQRRLRSPNDDISGYKENYTRWLCYCNVPQFCDSLPR
YETTQVFGRTLLRSVFTVMRRQLLEQARQEKDKLPLEKRTLILTHFPKFLSMLEEEVYSQ
NSPIWDQDFLSASSRTSQLGIQTVINPPPVAGTISYNSTSSSLEQPNAGSSSPACKASSG
LEANPGEKRKMTDSHVLEEAKKPRVMGDIPMELINEVMSTITDPAAMLGPETNFLSAHSA
RDEAARLEERRGVIEFHVVGNSLNQKPNKKILMWLVGLQNVFSHQLPRMPKEYITRLVFD
PKHKTLALIKDGRVIGGICFRMFPSQGFTEIVFCAVTSNEQVKGYGTHLMNHLKEYHIKH
DILNFLTYADEYAIGYFKKQGFSKEIKIPKTKYVGYIKDYEGATLMGCELNPRIPYTEFS
VIIKKQKEIIKKLIERKQAQIRKVYPGLSCFKDGVRQIPIESIPGIRETGWKPSGKEKSK
EPRDPDQLYSTLKSILQQVKSHQSAWPFMEPVKRTEAPGYYEVIRFPMDLKTMSERLKNR
YYVSKKLFMADLQRVFTNCKEYNPPESEYYKCANILEKFFFSKIKEAGLIDK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q92831	1.000	1.000	0.000	832	1.000	1.000	Q92831.pdb.gz	KAT2B_HUMAN Histone acetyltransferase KAT2B OS=Homo sapiens OX=9606 GN=KAT2B PE=1 SV=3
2	AFDB:Q1LUC3	0.482	0.500	1.177E-100	796	0.766	0.800	Q1LUC3.pdb.gz	KAT2B_DANRE Histone acetyltransferase KAT2B OS=Danio rerio OX=7955 GN=kat2b PE=2 SV=1
3	AFDB:A0A0R4IXF6	0.596	0.620	5.415E-95	795	0.710	0.743	A0A0R4IXF6.pdb.gz	KAT2A_DANRE Histone acetyltransferase KAT2A OS=Danio rerio OX=7955 GN=kat2a PE=2 SV=1
4	AFDB:Q92830	0.591	0.588	2.971E-93	837	0.710	0.706	Q92830.pdb.gz	KAT2A_HUMAN Histone acetyltransferase KAT2A OS=Homo sapiens OX=9606 GN=KAT2A PE=1 SV=3
5	AFDB:O76216	0.349	0.357	3.520E-72	813	0.452	0.462	O76216.pdb.gz	O76216_DROME histone acetyltransferase OS=Drosophila melanogaster OX=7227 GN=Gcn5 PE=1 SV=1
6	AFDB:Q9UUK2	0.262	0.431	3.532E-34	454	0.216	0.396	Q9UUK2.pdb.gz	GCN5_SCHPO Histone acetyltransferase gcn5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gcn5 PE=1 SV=1
7	AFDB:Q03330	0.250	0.450	1.216E-32	439	0.213	0.403	Q03330.pdb.gz	GCN5_YEAST Histone acetyltransferase GCN5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GCN5 PE=1 SV=1
8	AFDB:Q59PZ5	0.261	0.465	6.503E-32	449	0.203	0.376	Q59PZ5.pdb.gz	Q59PZ5_CANAL Histone acetyltransferase GCN5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=GCN5 PE=3 SV=1
9	AFDB:Q338B9	0.246	0.384	3.168E-31	511	0.212	0.344	Q338B9.pdb.gz	GCN5_ORYSJ Histone acetyltransferase GCN5 OS=Oryza sativa subsp. japonica OX=39947 GN=GCN5 PE=1 SV=1
10	AFDB:Q9AR19	0.255	0.359	3.816E-31	568	0.200	0.292	Q9AR19.pdb.gz	GCN5_ARATH Histone acetyltransferase GCN5 OS=Arabidopsis thaliana OX=3702 GN=HAG1 PE=1 SV=1
11	PDB:4ua3B	0.167	0.655	1.568E-5	194	0.017	0.072	4ua3B.pdb.gz	The Molecular Basis for Histone H4- and H2A-Specific Amino-Terminal Acetylation by NatD.
12	PDB:1tiqA	0.144	0.604	4.168E-5	173	0.037	0.179	1tiqA.pdb.gz	Structural and functional evidence for Bacillus subtilis PaiA as a novel N1-spermidine/spermine acetyltransferase.
13	PDB:3fixA	0.127	0.543	6.640E-5	165	0.029	0.145	3fixA.pdb.gz
14	PDB:5isvA	0.144	0.675	7.635E-5	156	0.029	0.154	5isvA.pdb.gz
15	PDB:5jq4B	0.149	0.737	1.685E-4	146	0.029	0.164	5jq4B.pdb.gz
16	PDB:2ob0C	0.136	0.540	3.087E-4	166	0.038	0.193	2ob0C.pdb.gz	Structure of Human MAK3 homolog
17	PDB:3owcA	0.119	0.493	4.481E-4	172	0.030	0.145	3owcA.pdb.gz	Crystal structure of GNAT superfamily protein PA2578 from Pseudomonas aeruginosa
18	PDB:2wpwA	0.138	0.328	6.504E-4	328	0.028	0.070	2wpwA.pdb.gz	Crystallographic and mass spectrometric analyses of a tandem GNAT protein from the clavulanic acid biosynthesis pathway.
19	PDB:5hgzA	0.141	0.478	1.036E-3	211	0.034	0.133	5hgzA.pdb.gz	Structure and function of human Naa60 (NatF), a Golgi-localized bi-functional acetyltransferase
20	PDB:7l1kA	0.146	0.677	1.137E-3	149	0.028	0.154	7l1kA.pdb.gz	Molecular mechanism of N-terminal acetylation by the ternary NatC complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0R4IXF6	0.0	1205	795	0.709	0.742	KAT2A_DANRE Histone acetyltransferase KAT2A OS=Danio rerio OX=7955 GN=kat2a PE=2 SV=1
2	A0A8I5Y222	0.0	1486	813	0.895	0.916	A0A8I5Y222_RAT Histone acetyltransferase OS=Rattus norvegicus OX=10116 GN=Kat2b PE=3 SV=1
3	A0A8J8YC15	0.0	1398	765	0.839	0.912	A0A8J8YC15_RAT Histone acetyltransferase OS=Rattus norvegicus OX=10116 GN=Kat2b PE=3 SV=1
4	D4ACX5	0.0	1149	833	0.686	0.685	D4ACX5_RAT Histone acetyltransferase OS=Rattus norvegicus OX=10116 GN=Kat2a PE=3 SV=3
5	O76216	0.0	715	813	0.438	0.448	O76216_DROME histone acetyltransferase OS=Drosophila melanogaster OX=7227 GN=Gcn5 PE=1 SV=1
6	Q1LUC3	0.0	1258	796	0.772	0.807	KAT2B_DANRE Histone acetyltransferase KAT2B OS=Danio rerio OX=7955 GN=kat2b PE=2 SV=1
7	Q92830	0.0	1149	837	0.684	0.680	KAT2A_HUMAN Histone acetyltransferase KAT2A OS=Homo sapiens OX=9606 GN=KAT2A PE=1 SV=3
8	Q92831	0.0	1728	832	1.000	1.000	KAT2B_HUMAN Histone acetyltransferase KAT2B OS=Homo sapiens OX=9606 GN=KAT2B PE=1 SV=3
9	Q9JHD1	0.0	1500	813	0.913	0.935	KAT2B_MOUSE Histone acetyltransferase KAT2B OS=Mus musculus OX=10090 GN=Kat2b PE=1 SV=2
10	Q9JHD2	0.0	1150	830	0.688	0.689	KAT2A_MOUSE Histone acetyltransferase KAT2A OS=Mus musculus OX=10090 GN=Kat2a PE=1 SV=2
11	Q9VTZ1	0.0	719	813	0.442	0.453	Q9VTZ1_DROME histone acetyltransferase OS=Drosophila melanogaster OX=7227 GN=Gcn5 PE=2 SV=1
12	Q9UUK2	1.00e-109	345	454	0.206	0.377	GCN5_SCHPO Histone acetyltransferase gcn5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gcn5 PE=1 SV=1
13	Q338B9	4.23e-104	332	511	0.198	0.323	GCN5_ORYSJ Histone acetyltransferase GCN5 OS=Oryza sativa subsp. japonica OX=39947 GN=GCN5 PE=1 SV=1
14	Q9AR19	2.15e-98	319	568	0.192	0.282	GCN5_ARATH Histone acetyltransferase GCN5 OS=Arabidopsis thaliana OX=3702 GN=HAG1 PE=1 SV=1
15	Q03330	4.95e-98	314	439	0.204	0.387	GCN5_YEAST Histone acetyltransferase GCN5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GCN5 PE=1 SV=1
16	Q59PZ5	1.16e-92	300	449	0.191	0.354	Q59PZ5_CANAL Histone acetyltransferase GCN5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=GCN5 PE=3 SV=1
17	Q8IB67	8.81e-87	304	1465	0.195	0.111	Q8IB67_PLAF7 Histone acetyltransferase GCN5 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0823300 PE=1 SV=2
18	Q568Z2	3.77e-50	172	84	0.096	0.952	Q568Z2_RAT p300/CBP-associated factor OS=Rattus norvegicus OX=10116 GN=Pcaf PE=2 SV=1
19	B1H2A3	6.23e-27	114	326	0.058	0.147	B1H2A3_RAT Falz protein OS=Rattus norvegicus OX=10116 GN=Falz PE=2 SV=1
20	A0A140LHY5	1.81e-26	113	329	0.056	0.143	A0A140LHY5_MOUSE Bromodomain PHD finger transcription factor (Fragment) OS=Mus musculus OX=10090 GN=Bptf PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00583 Acetyltransf_1	2.8e-06	39.0	Acetyltransferase (GNAT) family
2	PF13673 Acetyltransf_10	0.11	23.9	Acetyltransferase (GNAT) domain
3	PF13508 Acetyltransf_7	0.083	24.5	Acetyltransferase (GNAT) domain
4	PF00439 Bromodomain	6.3e-21	85.6	Bromodomain
5	PF06466 PCAF_N	6.1e-107	368.4	PCAF (P300/CBP-associated factor) N-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000263754

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000262367	0.999	CREB-binding protein
2	9606.ENSP00000263253	0.999	Histone acetyltransferase p300
3	9606.ENSP00000307684	0.999	Transcriptional adapter 3
4	9606.ENSP00000352925	0.999	Transformation/transcription domain-associated protein
5	9606.ENSP00000360515	0.999	Transcription initiation protein SPT3 homolog
6	9606.ENSP00000481091	0.999	Transcriptional adapter 2-alpha
7	9606.ENSP00000269305	0.998	Cellular tumor antigen p53
8	9606.ENSP00000316114	0.998	SAGA-associated factor 29
9	9606.ENSP00000250003	0.997	Myoblast determination protein 1
10	9606.ENSP00000299424	0.997	Transcription initiation factor TFIID subunit 10
11	9606.ENSP00000397259	0.997	Ataxin-7-like protein 3
12	9606.ENSP00000479618	0.997	Myc proto-oncogene protein
13	9606.ENSP00000258281	0.995	TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L
14	9606.ENSP00000261497	0.995	Ubiquitin carboxyl-terminal hydrolase 22
15	9606.ENSP00000308022	0.995	Transcriptional adapter 2-beta
16	9606.ENSP00000332973	0.995	Mothers against decapentaplegic homolog 3
17	9606.ENSP00000369497	0.995	Breast cancer type 2 susceptibility protein
18	9606.ENSP00000294168	0.994	TAF6-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 6L
19	9606.ENSP00000356848	0.993	Transcriptional adapter 1
20	9606.ENSP00000385216	0.993	Nuclear receptor coactivator 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003713	1.000	transcription coactivator activity
GO:0042826	1.000	histone deacetylase binding
GO:0004402	1.000	histone acetyltransferase activity
GO:0003682	0.999	chromatin binding
GO:0140297	0.999	DNA-binding transcription factor binding
GO:0010484	0.992	histone H3 acetyltransferase activity
GO:0003676	0.350	nucleic acid binding
GO:0003677	0.315	DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.997	biological regulation
GO:0071704	0.993	organic substance metabolic process
GO:0044238	0.992	primary metabolic process
GO:0050794	0.990	regulation of cellular process
GO:0080090	0.990	regulation of primary metabolic process
GO:0060255	0.987	regulation of macromolecule metabolic process
GO:0051171	0.986	regulation of nitrogen compound metabolic process
GO:0009893	0.985	positive regulation of metabolic process
GO:0009987	0.984	cellular process
GO:0009889	0.983	regulation of biosynthetic process
GO:0051254	0.975	positive regulation of RNA metabolic process
GO:0006807	0.969	nitrogen compound metabolic process
GO:0043170	0.946	macromolecule metabolic process
GO:0006355	0.946	regulation of DNA-templated transcription
GO:0006357	0.937	regulation of transcription by RNA polymerase II
GO:0031328	0.923	positive regulation of cellular biosynthetic process
GO:0010557	0.917	positive regulation of macromolecule biosynthetic process
GO:0006473	0.890	protein acetylation
GO:0045944	0.877	positive regulation of transcription by RNA polymerase II
GO:0065009	0.842	regulation of molecular function
GO:0051246	0.684	regulation of protein metabolic process
GO:0048519	0.679	negative regulation of biological process
GO:0050896	0.616	response to stimulus
GO:0048523	0.574	negative regulation of cellular process
GO:0031399	0.540	regulation of protein modification process
GO:0071840	0.538	cellular component organization or biogenesis
GO:0051716	0.504	cellular response to stimulus
GO:0016043	0.498	cellular component organization
GO:0010605	0.469	negative regulation of macromolecule metabolic process
GO:0031324	0.459	negative regulation of cellular metabolic process
GO:0051172	0.450	negative regulation of nitrogen compound metabolic process
GO:0018193	0.450	peptidyl-amino acid modification
GO:0044237	0.437	cellular metabolic process
GO:0051128	0.435	regulation of cellular component organization
GO:0032501	0.400	multicellular organismal process
GO:0016570	0.394	histone modification
GO:0018205	0.357	peptidyl-lysine modification
GO:0006338	0.347	chromatin remodeling
GO:0018393	0.305	internal peptidyl-lysine acetylation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0000785	1.000	chromatin
GO:0005654	0.999	nucleoplasm
GO:0140535	0.998	intracellular protein-containing complex
GO:1990234	0.998	transferase complex
GO:0005829	0.977	cytosol
GO:0000123	0.975	histone acetyltransferase complex
GO:0140672	0.957	ATAC complex
GO:0005856	0.701	cytoskeleton
GO:0015630	0.478	microtubule cytoskeleton

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:21992	1.000	acetyl-CoA + L-lysyl-[histone] = CoA + H(+) + N(6)-acetyl-L-lysyl-[histone]
EC:2.3.1.48	1.000	histone acetyltransferase.

[back to server]