StarFunc result for job id Q92832

User Input

>input (810 residues)
MPMDLILVVWFCVCTARTVVGFGMDPDLQMDIVTELDLVNTTLGVAQVSGMHNASKAFLF
QDIEREIHAAPHVSEKLIQLFRNKSEFTILATVQQKPSTSGVILSIRELEHSYFELESSG
LRDEIRYHYIHNGKPRTEALPYRMADGQWHKVALSVSASHLLLHVDCNRIYERVIDPPDT
NLPPGINLWLGQRNQKHGLFKGIIQDGKIIFMPNGYITQCPNLNHTCPTCSDFLSLVQGI
MDLQELLAKMTAKLNYAETRLSQLENCHCEKTCQVSGLLYRDQDSWVDGDHCRNCTCKSG
AVECRRMSCPPLNCSPDSLPVHIAGQCCKVCRPKCIYGGKVLAEGQRILTKSCRECRGGV
LVKITEMCPPLNCSEKDHILPENQCCRVCRGHNFCAEGPKCGENSECKNWNTKATCECKS
GYISVQGDSAYCEDIDECAAKMHYCHANTVCVNLPGLYRCDCVPGYIRVDDFSCTEHDEC
GSGQHNCDENAICTNTVQGHSCTCKPGYVGNGTICRAFCEEGCRYGGTCVAPNKCVCPSG
FTGSHCEKDIDECSEGIIECHNHSRCVNLPGWYHCECRSGFHDDGTYSLSGESCIDIDEC
ALRTHTCWNDSACINLAGGFDCLCPSGPSCSGDCPHEGGLKHNGQVWTLKEDRCSVCSCK
DGKIFCRRTACDCQNPSADLFCCPECDTRVTSQCLDQNGHKLYRSGDNWTHSCQQCRCLE
GEVDCWPLTCPNLSCEYTAILEGECCPRCVSDPCLADNITYDIRKTCLDSYGVSRLSGSV
WTMAGSPCTTCKCKNGRVCCSVDFECLQNN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q61220	0.332	0.329	0.000	819	0.549	0.543	Q61220.pdb.gz	NELL2_MOUSE Protein kinase C-binding protein NELL2 OS=Mus musculus OX=10090 GN=Nell2 PE=1 SV=3
2	AFDB:Q62919	0.659	0.659	0.000	810	0.925	0.925	Q62919.pdb.gz	NELL1_RAT Protein kinase C-binding protein NELL1 OS=Rattus norvegicus OX=10116 GN=Nell1 PE=2 SV=2
3	AFDB:Q90827	0.538	0.534	0.000	816	0.551	0.547	Q90827.pdb.gz	NEL_CHICK Protein NEL OS=Gallus gallus OX=9031 GN=NEL PE=2 SV=1
4	AFDB:D4A2G6	0.233	0.163	1.466E-28	1172	0.143	0.099	D4A2G6.pdb.gz	D4A2G6_RAT Thrombospondin 2 OS=Rattus norvegicus OX=10116 GN=Thbs2 PE=3 SV=2
5	AFDB:P35442	0.231	0.162	2.569E-27	1172	0.152	0.105	P35442.pdb.gz	TSP2_HUMAN Thrombospondin-2 OS=Homo sapiens OX=9606 GN=THBS2 PE=1 SV=2
6	AFDB:A0A0G2JV24	0.187	0.137	1.294E-20	1152	0.148	0.104	A0A0G2JV24.pdb.gz	A0A0G2JV24_RAT Thrombospondin 1 OS=Rattus norvegicus OX=10116 GN=Thbs1 PE=1 SV=2
7	AFDB:P49744	0.176	0.148	4.154E-20	980	0.142	0.117	P49744.pdb.gz	TSP4_RAT Thrombospondin-4 OS=Rattus norvegicus OX=10116 GN=Thbs4 PE=1 SV=1
8	AFDB:P10040	0.125	0.055	5.889E-19	2146	0.170	0.064	P10040.pdb.gz	CRB_DROME Protein crumbs OS=Drosophila melanogaster OX=7227 GN=crb PE=1 SV=3
9	AFDB:M9MMB9	0.103	0.103	9.492E-19	815	0.141	0.140	M9MMB9.pdb.gz
10	AFDB:P37889	0.081	0.059	2.741E-18	1221	0.151	0.100	P37889.pdb.gz	FBLN2_MOUSE Fibulin-2 OS=Mus musculus OX=10090 GN=Fbln2 PE=1 SV=2
11	PDB:7q3nU	0.099	0.229	1.628E-8	292	0.063	0.175	7q3nU.pdb.gz	Structure of the decoy module of human glycoprotein 2 and uromodulin and its interaction with bacterial adhesin FimH.
12	PDB:3v0aB	0.173	0.125	6.815E-8	1150	0.038	0.027	3v0aB.pdb.gz	Botulinum neurotoxin is shielded by NTNHA in an interlocked complex.
13	PDB:2a3wA	0.127	0.427	2.646E-6	204	0.019	0.074	2a3wA.pdb.gz	Ligand-assisted Aggregation of Proteins: DIMERIZATION OF SERUM AMYLOID P COMPONENT BY BIVALENT LIGANDS.
14	PDB:7qfqA	0.141	0.093	3.450E-6	1291	0.056	0.035	7qfqA.pdb.gz
15	PDB:4pbpB	0.125	0.420	8.961E-6	210	0.027	0.105	4pbpB.pdb.gz	Crystal structures for short-chain pentraxin from zebrafish demonstrate a cyclic trimer with new recognition and effector faces.
16	PDB:7ufgB	0.156	0.110	8.961E-6	1182	0.030	0.020	7ufgB.pdb.gz	Structure of the PAPP-ABP5 complex reveals mechanism of substrate recognition
17	PDB:3ffzA	0.133	0.089	1.299E-5	1246	0.027	0.018	3ffzA.pdb.gz	Domain organization in Clostridium botulinum neurotoxin type E is unique: its implication in faster translocation.
18	PDB:7zl1A	0.137	0.468	1.444E-5	215	0.028	0.107	7zl1A.pdb.gz
19	PDB:3vv1A	0.129	0.559	1.523E-5	141	0.014	0.078	3vv1A.pdb.gz	Structural basis of preferential binding of fucose-containing saccharide by the Caenorhabditis elegans galectin LEC-6
20	PDB:5n0cA	0.155	0.101	2.729E-5	1293	0.038	0.024	5n0cA.pdb.gz	The structure of the tetanus toxin reveals pH-mediated domain dynamics.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q61220	0.0	962	819	0.556	0.549	NELL2_MOUSE Protein kinase C-binding protein NELL2 OS=Mus musculus OX=10090 GN=Nell2 PE=1 SV=3
2	Q62918	0.0	951	816	0.549	0.545	NELL2_RAT Protein kinase C-binding protein NELL2 OS=Rattus norvegicus OX=10116 GN=Nell2 PE=2 SV=1
3	Q62919	0.0	1571	810	0.926	0.926	NELL1_RAT Protein kinase C-binding protein NELL1 OS=Rattus norvegicus OX=10116 GN=Nell1 PE=2 SV=2
4	Q90827	0.0	955	816	0.551	0.547	NEL_CHICK Protein NEL OS=Gallus gallus OX=9031 GN=NEL PE=2 SV=1
5	Q92832	0.0	1659	810	1.000	1.000	NELL1_HUMAN Protein kinase C-binding protein NELL1 OS=Homo sapiens OX=9606 GN=NELL1 PE=1 SV=4
6	Q99435	0.0	963	816	0.556	0.551	NELL2_HUMAN Protein kinase C-binding protein NELL2 OS=Homo sapiens OX=9606 GN=NELL2 PE=1 SV=1
7	P35556	2.53e-25	115	2912	0.112	0.031	FBN2_HUMAN Fibrillin-2 OS=Homo sapiens OX=9606 GN=FBN2 PE=1 SV=3
8	P98133	6.27e-25	114	2871	0.109	0.031	FBN1_BOVIN Fibrillin-1 OS=Bos taurus OX=9913 GN=FBN1 PE=1 SV=2
9	Q61555	8.33e-25	114	2907	0.112	0.031	FBN2_MOUSE Fibrillin-2 OS=Mus musculus OX=10090 GN=Fbn2 PE=1 SV=2
10	Q8NDA2	2.54e-24	112	5059	0.130	0.021	HMCN2_HUMAN Hemicentin-2 OS=Homo sapiens OX=9606 GN=HMCN2 PE=2 SV=3
11	Q14246	2.70e-24	111	886	0.114	0.104	AGRE1_HUMAN Adhesion G protein-coupled receptor E1 OS=Homo sapiens OX=9606 GN=ADGRE1 PE=2 SV=3
12	P35555	2.83e-24	112	2871	0.107	0.030	FBN1_HUMAN Fibrillin-1 OS=Homo sapiens OX=9606 GN=FBN1 PE=1 SV=4
13	A2AJ76	3.55e-24	112	5100	0.140	0.022	HMCN2_MOUSE Hemicentin-2 OS=Mus musculus OX=10090 GN=Hmcn2 PE=1 SV=1
14	Q61554	4.09e-24	112	2873	0.107	0.030	FBN1_MOUSE Fibrillin-1 OS=Mus musculus OX=10090 GN=Fbn1 PE=1 SV=2
15	M9PB31	7.49e-24	111	20404	0.109	0.004	M9PB31_DROME Dumpy, isoform V OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
16	A0A8I6A897	9.99e-24	110	2813	0.106	0.031	A0A8I6A897_RAT Fibrillin 1 OS=Rattus norvegicus OX=10116 GN=Fbn1 PE=1 SV=1
17	A0A8I6G7Y9	1.09e-23	110	2861	0.106	0.030	A0A8I6G7Y9_RAT Fibrillin 1 OS=Rattus norvegicus OX=10116 GN=Fbn1 PE=1 SV=1
18	G3V9M6	1.31e-23	110	2872	0.106	0.030	G3V9M6_RAT Fibrillin 1 OS=Rattus norvegicus OX=10116 GN=Fbn1 PE=1 SV=1
19	M9NCR4	2.81e-23	109	15105	0.117	0.006	M9NCR4_DROME Dumpy, isoform J OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
20	M9PBZ0	2.84e-23	109	22830	0.116	0.004	M9PBZ0_DROME Dumpy, isoform R OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12662 cEGF	1.3e-05	36.3	Complement Clr-like EGF-like
2	PF00008 EGF	0.064	24.9	EGF-like domain
3	PF07974 EGF_2	5.7	18.7	EGF-like domain
4	PF12947 EGF_3	6.2e-12	56.8	EGF domain
5	PF07645 EGF_CA	3.7e-21	86.3	Calcium-binding EGF domain
6	PF14670 FXa_inhibition	61	15.4	Coagulation Factor Xa inhibitory site
7	PF12661 hEGF	2.1	20.3	Human growth factor-like EGF
8	PF00054 Laminin_G_1	17	17.0	Laminin G domain
9	PF02210 Laminin_G_2	0.18	23.8	Laminin G domain
10	PF13385 Laminin_G_3	3.4	19.2	Concanavalin A-like lectin/glucanases superfamily
11	PF06247 Plasmod_Pvs28	10	17.8	Pvs28 EGF domain
12	PF12714 TILa	0.0029	28.8	TILa domain
13	PF00093 VWC	1.6e-16	71.7	von Willebrand factor type C domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_003830501.1

Rank	PPI partner	STRING score	Description
1	9597.XP_003819980.1	0.751	Roundabout guidance receptor 3
2	9597.XP_008965875.1	0.712	Belongs to the integrin beta chain family.
3	9597.XP_008949279.1	0.702	E3 ubiquitin-protein ligase NEURL1
4	9597.XP_003825802.1	0.695	Anoctamin-6 isoform X1
5	9597.XP_008964864.1	0.695	E3 ubiquitin-protein ligase NEURL1B
6	9597.XP_003830500.1	0.665	Anoctamin-5 isoform X1
7	9597.XP_003811696.1	0.639	Methyltransferase-like protein 25
8	9597.XP_003808307.1	0.633	FYVE, RhoGEF and PH domain containing 6
9	9597.XP_003833162.1	0.610	Tubulin tyrosine ligase like 11
10	9597.XP_003812593.1	0.601	Zinc finger protein 362
11	9597.XP_008974245.1	0.582	General transcription factor IIIC subunit 5
12	9597.XP_003832923.1	0.581	Synaptotagmin 1
13	9597.XP_008951963.1	0.548	Roundabout homolog 2 isoform X1
14	9597.XP_008968300.1	0.546	Glycosyltransferase 6 domain containing 1
15	9597.XP_003832669.1	0.536	Cilia and flagella associated protein 54
16	9597.XP_008956350.1	0.536	Uncharacterized protein C12orf55
17	9597.XP_003808281.1	0.530	C-Jun-amino-terminal kinase-interacting protein 1
18	9597.XP_003827137.1	0.528	All-trans retinoic acid-induced differentiation factor isoform X1
19	9597.XP_003830414.1	0.526	Peptidase domain containing associated with muscle regeneration 1
20	9597.XP_003815692.2	0.521	E3 ubiquitin-protein ligase MIB1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:1901681	0.990	sulfur compound binding
GO:0008201	0.984	heparin binding
GO:0005080	0.957	protein kinase C binding
GO:0042802	0.722	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.996	regulation of biological process
GO:0050794	0.992	regulation of cellular process
GO:0048522	0.959	positive regulation of cellular process
GO:0030278	0.954	regulation of ossification
GO:0045667	0.949	regulation of osteoblast differentiation
GO:0032502	0.885	developmental process
GO:0009987	0.885	cellular process
GO:0045597	0.832	positive regulation of cell differentiation
GO:0045778	0.768	positive regulation of ossification
GO:0048856	0.762	anatomical structure development
GO:0048519	0.731	negative regulation of biological process
GO:0032501	0.714	multicellular organismal process
GO:2000026	0.679	regulation of multicellular organismal development
GO:0007275	0.576	multicellular organism development
GO:0048731	0.492	system development
GO:0019222	0.489	regulation of metabolic process
GO:0048523	0.421	negative regulation of cellular process
GO:0070167	0.341	regulation of biomineral tissue development
GO:0050896	0.323	response to stimulus
GO:0060255	0.310	regulation of macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	0.998	extracellular region
GO:0005622	0.978	intracellular anatomical structure
GO:0005737	0.969	cytoplasm
GO:0016020	0.872	membrane
GO:0005615	0.870	extracellular space
GO:0071944	0.830	cell periphery
GO:0043226	0.802	organelle
GO:0043227	0.755	membrane-bounded organelle
GO:0043231	0.606	intracellular membrane-bounded organelle
GO:0012505	0.444	endomembrane system
GO:0005634	0.306	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]