StarFunc result for job id Q92834

User Input

>input (1020 residues)
MREPEELMPDSGAVFTFGKSKFAENNPGKFWFKNDVPVHLSCGDEHSAVVTGNNKLYMFG
SNNWGQLGLGSKSAISKPTCVKALKPEKVKLAACGRNHTLVSTEGGNVYATGGNNEGQLG
LGDTEERNTFHVISFFTSEHKIKQLSAGSNTSAALTEDGRLFMWGDNSEGQIGLKNVSNV
CVPQQVTIGKPVSWISCGYYHSAFVTTDGELYVFGEPENGKLGLPNQLLGNHRTPQLVSE
IPEKVIQVACGGEHTVVLTENAVYTFGLGQFGQLGLGTFLFETSEPKVIENIRDQTISYI
SCGENHTALITDIGLMYTFGDGRHGKLGLGLENFTNHFIPTLCSNFLRFIVKLVACGGCH
MVVFAAPHRGVAKEIEFDEINDTCLSVATFLPYSSLTSGNVLQRTLSARMRRRERERSPD
SFSMRRTLPPIEGTLGLSACFLPNSVFPRCSERNLQESVLSEQDLMQPEEPDYLLDEMTK
EAEIDNSSTVESLGETTDILNMTHIMSLNSNEKSLKLSPVQKQKKQQTIGELTQDTALTE
NDDSDEYEEMSEMKEGKACKQHVSQGIFMTQPATTIEAFSDEEVGNDTGQVGPQADTDGE
GLQKEVYRHENNNGVDQLDAKEIEKESDGGHSQKESEAEEIDSEKETKLAEIAGMKDLRE
REKSTKKMSPFFGNLPDRGMNTESEENKDFVKKRESCKQDVIFDSERESVEKPDSYMEGA
SESQQGIADGFQQPEAIEFSSGEKEDDEVETDQNIRYGRKLIEQGNEKETKPIISKSMAK
YDFKCDRLSEIPEEKEGAEDSKGNGIEEQEVEANEENVKVHGGRKEKTEILSDDLTDKAE
DHEFSKTEELKLEDVDEEINAENVESKKKTVGDDESVPTGYHSKTEGAERTNDDSSAETI
EKKEKANLEERAICEYNENPKGYMLDDADSSSLEILENSETTPSKDMKKTKKIFLFKRVP
SINQKIVKNNNEPLPEIKSIGDQIILKSDNKDADQNHMSQNHQNIPPTNTERRSKSCTIL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q92834	0.999	0.999	0.000	1020	1.000	1.000	Q92834.pdb.gz	RPGR_HUMAN X-linked retinitis pigmentosa GTPase regulator OS=Homo sapiens OX=9606 GN=RPGR PE=1 SV=2
2	AFDB:Q9R0X5	0.442	0.450	8.361E-102	1001	0.579	0.590	Q9R0X5.pdb.gz	RPGR_MOUSE X-linked retinitis pigmentosa GTPase regulator OS=Mus musculus OX=10090 GN=Rpgr PE=1 SV=2
3	AFDB:B1WC72	0.392	0.583	4.248E-82	677	0.378	0.570	B1WC72.pdb.gz	B1WC72_RAT Rpgr protein OS=Rattus norvegicus OX=10116 GN=Rpgr PE=1 SV=1
4	AFDB:D2X8A0	0.385	0.545	8.809E-77	708	0.323	0.465	D2X8A0.pdb.gz
5	AFDB:F1QM29	0.388	0.284	1.166E-72	1413	0.365	0.263	F1QM29.pdb.gz	F1QM29_DANRE Retinitis pigmentosa GTPase regulator b OS=Danio rerio OX=7955 GN=rpgrb PE=4 SV=1
6	PDB:8gqeB	0.297	0.775	1.167E-33	386	0.101	0.267	8gqeB.pdb.gz
7	PDB:5tbkI	0.322	0.752	8.806E-29	419	0.083	0.203	5tbkI.pdb.gz
8	PDB:5xgsA	0.316	0.782	1.633E-27	398	0.093	0.239	5xgsA.pdb.gz
9	PDB:5t94A	0.333	0.718	4.487E-27	454	0.087	0.196	5t94A.pdb.gz
10	AFDB:Q54PV1	0.306	0.177	3.558E-26	1800	0.190	0.108	Q54PV1.pdb.gz	Q54PV1_DICDI Inositol 5-phosphatase OS=Dictyostelium discoideum OX=44689 GN=Dd5P2 PE=4 SV=1
11	PDB:4d4oA	0.269	0.625	7.429E-19	414	0.069	0.169	4d4oA.pdb.gz	Structure of the Kti11/Kti13 Heterodimer and its Double Role in Modifications of tRNA and Eukaryotic Elongation Factor 2.
12	PDB:7ajtUO	0.174	0.326	2.157E-10	493	0.052	0.108	7ajtUO.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
13	PDB:7d5sBE	0.168	0.194	6.630E-10	865	0.038	0.045	7d5sBE.pdb.gz	Cryo-EM structure of 90S preribosome with inactive Utp24 (state A2)
14	PDB:7d4iBE	0.162	0.181	1.163E-9	890	0.039	0.045	7d4iBE.pdb.gz	Cryo-EM structure of 90S small ribosomal precursors complex with Dhr1
15	PDB:7zgrD	0.186	0.426	1.722E-9	395	0.031	0.081	7zgrD.pdb.gz	Mpe1 senses the binding of pre-mRNA and controls 3' end processing by CPF.
16	AFDB:P40477	0.183	0.134	2.141E-9	1460	0.147	0.103	P40477.pdb.gz	NU159_YEAST Nucleoporin NUP159 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NUP159 PE=1 SV=1
17	PDB:1nr0A	0.190	0.297	2.156E-9	610	0.033	0.056	1nr0A.pdb.gz
18	AFDB:P25365	0.182	0.176	2.835E-9	1065	0.139	0.133	P25365.pdb.gz	SED4_YEAST Putative guanine nucleotide-exchange factor SED4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SED4 PE=1 SV=1
19	AFDB:M9PB01	0.180	0.087	1.291E-8	2397	0.132	0.056	M9PB01.pdb.gz	M9PB01_DROME WD repeat domain 62, isoform G OS=Drosophila melanogaster OX=7227 GN=Wdr62 PE=4 SV=1
20	AFDB:F1LRR4	0.132	0.095	2.680E-8	1551	0.157	0.103	F1LRR4.pdb.gz	F1LRR4_RAT WD repeat domain 62 OS=Rattus norvegicus OX=10116 GN=Wdr62 PE=1 SV=4

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I6A4C7	0.0	770	685	0.376	0.561	A0A8I6A4C7_RAT Retinitis pigmentosa GTPase regulator OS=Rattus norvegicus OX=10116 GN=Rpgr PE=4 SV=1
2	A0A8I6AFA8	0.0	1125	1035	0.596	0.587	A0A8I6AFA8_RAT Retinitis pigmentosa GTPase regulator OS=Rattus norvegicus OX=10116 GN=Rpgr PE=4 SV=1
3	A0A8I6ANX7	0.0	771	685	0.376	0.561	A0A8I6ANX7_RAT Retinitis pigmentosa GTPase regulator OS=Rattus norvegicus OX=10116 GN=Rpgr PE=4 SV=1
4	B1WC72	0.0	739	677	0.363	0.547	B1WC72_RAT Rpgr protein OS=Rattus norvegicus OX=10116 GN=Rpgr PE=1 SV=1
5	F1QEL3	0.0	611	708	0.300	0.432	F1QEL3_DANRE Retinitis pigmentosa GTPase regulator b OS=Danio rerio OX=7955 GN=rpgrb PE=4 SV=1
6	F1QM29	0.0	624	1413	0.295	0.213	F1QM29_DANRE Retinitis pigmentosa GTPase regulator b OS=Danio rerio OX=7955 GN=rpgrb PE=4 SV=1
7	F7F384	0.0	742	729	0.363	0.508	F7F384_RAT Retinitis pigmentosa GTPase regulator OS=Rattus norvegicus OX=10116 GN=Rpgr PE=1 SV=1
8	Q92834	0.0	2105	1020	1.000	1.000	RPGR_HUMAN X-linked retinitis pigmentosa GTPase regulator OS=Homo sapiens OX=9606 GN=RPGR PE=1 SV=2
9	Q9R0X5	0.0	1084	1001	0.592	0.603	RPGR_MOUSE X-linked retinitis pigmentosa GTPase regulator OS=Mus musculus OX=10090 GN=Rpgr PE=1 SV=2
10	Q9GMD3	7.57e-80	282	934	0.172	0.187	Q9GMD3_BOVIN Retinitis pigmentosa GTPase regulator (Fragment) OS=Bos taurus OX=9913 GN=RPGR PE=1 SV=1
11	Q9FN03	8.97e-45	170	440	0.102	0.236	UVR8_ARATH Ultraviolet-B receptor UVR8 OS=Arabidopsis thaliana OX=3702 GN=UVR8 PE=1 SV=1
12	Q6PAV2	4.65e-37	153	1057	0.102	0.098	HERC4_MOUSE Probable E3 ubiquitin-protein ligase HERC4 OS=Mus musculus OX=10090 GN=Herc4 PE=1 SV=2
13	E8NHA2	8.14e-37	152	1062	0.105	0.101	E8NHA2_DROME HECT and RLD domain containing E3 ubiquitin ligase 4, isoform C OS=Drosophila melanogaster OX=7227 GN=Herc4 PE=1 SV=1
14	Q5GLZ8	1.44e-36	152	1057	0.100	0.096	HERC4_HUMAN Probable E3 ubiquitin-protein ligase HERC4 OS=Homo sapiens OX=9606 GN=HERC4 PE=1 SV=1
15	F2Z461	7.50e-36	149	1003	0.101	0.103	HERC6_MOUSE E3 ISG15--protein ligase Herc6 OS=Mus musculus OX=10090 GN=Herc6 PE=2 SV=1
16	Q15751	9.99e-35	147	4861	0.106	0.022	HERC1_HUMAN Probable E3 ubiquitin-protein ligase HERC1 OS=Homo sapiens OX=9606 GN=HERC1 PE=1 SV=2
17	E9PZP8	1.69e-34	146	4859	0.103	0.022	E9PZP8_MOUSE HECT and RLD domain containing E3 ubiquitin protein ligase family member 1 OS=Mus musculus OX=10090 GN=Herc1 PE=1 SV=1
18	C9JW69	5.14e-33	134	372	0.114	0.312	C9JW69_HUMAN Regulator of chromosome condensation 1 (Fragment) OS=Homo sapiens OX=9606 GN=RCC1 PE=1 SV=1
19	Q54D12	2.45e-32	134	455	0.103	0.231	Q54D12_DICDI Regulator of chromosome condensation domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0292586 PE=4 SV=1
20	O95199	1.30e-31	133	551	0.097	0.180	RCBT2_HUMAN RCC1 and BTB domain-containing protein 2 OS=Homo sapiens OX=9606 GN=RCBTB2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07646 Kelch_2	1.9e+02	13.5	Kelch motif
2	PF13418 Kelch_4	0.0069	27.6	Galactose oxidase, central domain
3	PF13854 Kelch_5	1.5e+02	13.6	Kelch motif
4	PF13964 Kelch_6	2.7e+02	13.3	Kelch motif
5	PF00415 RCC1	5e-68	236.8	Regulator of chromosome condensation (RCC1) repeat
6	PF13540 RCC1_2	1.6e-36	134.6	Regulator of chromosome condensation (RCC1) repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_008966596.1

Rank	PPI partner	STRING score	Description
1	9597.XP_008951950.1	0.990	Centrosomal protein of 290 kDa isoform X1
2	9597.XP_003825225.1	0.987	IQ motif containing B1
3	9597.XP_003822208.1	0.986	Nephrocystin 4
4	9597.XP_003833065.1	0.986	Intraflagellar transport 88
5	9597.XP_008950154.1	0.984	Nephrocystin-1 isoform X1
6	9597.XP_008961613.1	0.977	Retinitis pigmentosa GTPase regulator interacting protein 1
7	9597.XP_003829345.1	0.967	Belongs to the TRAFAC class myosin-kinesin ATPase superfamily. Kinesin family
8	9597.XP_008972326.1	0.967	Inversin isoform X1
9	9597.XP_008975740.1	0.965	Pericentrin
10	9597.XP_003821919.1	0.964	Promotes the release of prenylated target proteins from cellular membranes. Modulates the activity of prenylated or palmitoylated Ras family members by regulating their subcellular location. Required for normal ciliary targeting of farnesylated target proteins, such as INPP5E. Modulates the subcellular location of target proteins by acting as a GTP specific dissociation inhibitor (GDI). Increases the affinity of ARL3 for GTP by several orders of magnitude. Stabilizes ARL3-GTP by decreasing the nucleotide dissociation rate.
11	9597.XP_008960960.1	0.961	Dynactin subunit 1 isoform X1
12	9597.XP_003822826.1	0.959	Centrin-3
13	9597.XP_003824906.1	0.958	Dynactin subunit 2 isoform X1
14	9597.XP_008975093.1	0.958	RP1, axonemal microtubule associated
15	9597.XP_003813939.1	0.924	Tubulin is the major constituent of microtubules. The gamma chain is found at microtubule organizing centers (MTOC) such as the spindle poles or the centrosome
16	9597.XP_003813941.1	0.924	Tubulin is the major constituent of microtubules. The gamma chain is found at microtubule organizing centers (MTOC) such as the spindle poles or the centrosome
17	9597.XP_003822063.1	0.914	RPGRIP1 like
18	9597.XP_003816884.1	0.814	Tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein epsilon
19	9597.XP_003817987.1	0.814	14-3-3 protein epsilon-like
20	9597.XP_008974665.1	0.814	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 35 ESTs, 15 Proteins, and 84% coverage of the annotated genomic feature by RNAseq alignments

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003723	1.000	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.989	cellular process
GO:0032501	0.960	multicellular organismal process
GO:0071840	0.930	cellular component organization or biogenesis
GO:0051179	0.928	localization
GO:0050953	0.919	sensory perception of light stimulus
GO:0007601	0.903	visual perception
GO:0051234	0.896	establishment of localization
GO:0006810	0.893	transport
GO:0051641	0.810	cellular localization
GO:0016043	0.798	cellular component organization
GO:0006996	0.678	organelle organization
GO:0046907	0.670	intracellular transport
GO:0044782	0.593	cilium organization
GO:0044085	0.572	cellular component biogenesis
GO:0033036	0.567	macromolecule localization
GO:0008104	0.519	protein localization
GO:0071702	0.514	organic substance transport
GO:0022607	0.496	cellular component assembly
GO:0071705	0.396	nitrogen compound transport
GO:0015031	0.312	protein transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005929	0.998	cilium
GO:0012505	0.997	endomembrane system
GO:0043232	0.995	intracellular non-membrane-bounded organelle
GO:0005737	0.972	cytoplasm
GO:0043231	0.962	intracellular membrane-bounded organelle
GO:0015630	0.909	microtubule cytoskeleton
GO:0005815	0.880	microtubule organizing center
GO:0043005	0.850	neuron projection
GO:0097733	0.677	photoreceptor cell cilium
GO:0005794	0.562	Golgi apparatus
GO:0005813	0.451	centrosome
GO:0001750	0.348	photoreceptor outer segment

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]