StarFunc result for job id Q92835

User Input

>input (1189 residues)
MVPCWNHGNITRSKAEELLSRTGKDGSFLVRASESISRAYALCVLYRNCVYTYRILPNED
DKFTVQASEGVSMRFFTKLDQLIEFYKKENMGLVTHLQYPVPLEEEDTGDDPEEDTVESV
VSPPELPPRNIPLTASSCEAKEVPFSNENPRATETSRPSLSETLFQRLQSMDTSGLPEEH
LKAIQDYLSTQLAQDSEFVKTGSSSLPHLKKLTTLLCKELYGEVIRTLPSLESLQRLFDQ
QLSPGLRPRPQVPGEANPINMVSKLSQLTSLLSSIEDKVKALLHEGPESPHRPSLIPPVT
FEVKAESLGIPQKMQLKVDVESGKLIIKKSKDGSEDKFYSHKKILQLIKSQKFLNKLVIL
VETEKEKILRKEYVFADSKKREGFCQLLQQMKNKHSEQPEPDMITIFIGTWNMGNAPPPK
KITSWFLSKGQGKTRDDSADYIPHDIYVIGTQEDPLSEKEWLEILKHSLQEITSVTFKTV
AIHTLWNIRIVVLAKPEHENRISHICTDNVKTGIANTLGNKGAVGVSFMFNGTSLGFVNS
HLTSGSEKKLRRNQNYMNILRFLALGDKKLSPFNITHRFTHLFWFGDLNYRVDLPTWEAE
TIIQKIKQQQYADLLSHDQLLTERREQKVFLHFEEEEITFAPTYRFERLTRDKYAYTKQK
ATGMKYNLPSWCDRVLWKSYPLVHVVCQSYGSTSDIMTSDHSPVFATFEAGVTSQFVSKN
GPGTVDSQGQIEFLRCYATLKTKSQTKFYLEFHSSCLESFVKSQEGENEEGSEGELVVKF
GETLPKLKPIISDPEYLLDQHILISIKSSDSDESYGEGCIALRLEATETQLPIYTPLTHH
GELTGHFQGEIKLQTSQGKTREKLYDFVKTERDESSGPKTLKSLTSHDPMKQWEVTSRAP
PCSGSSITEIINPNYMGVGPFGPPMPLHVKQTLSPDQQPTAWSYDQPPKDSPLGPCRGES
PPTPPGQPPISPKKFLPSTANRGLPPRTQESRPSDLGKNAGDTLPQEDLPLTKPEMFENP
LYGSLSSFPKPAPRKDQESPKMPRKEPPPCPEPGILSPSIVLTKAQEADRGEGPGKQVPA
PRLRSFTCSSSAEGRAAGGDKSQGKPKTPVSSQAPVPAKRPIKPSRSEINQQTPPTPTPR
PPLPVKSPAVLHLQHSKGRDYRDNTELPHHGKHRPEEGPPGPLGRTAMQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:D7PF45	0.499	0.472	0.000	1260	0.417	0.394	D7PF45.pdb.gz	SHIP2_PIG Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2 OS=Sus scrofa OX=9823 GN=INPPL1 PE=1 SV=2
2	AFDB:Q2I6J1	0.505	0.477	0.000	1266	0.440	0.413	Q2I6J1.pdb.gz	SHP2A_DANRE Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2A OS=Danio rerio OX=7955 GN=inppl1a PE=2 SV=2
3	AFDB:Q92835	0.999	0.999	0.000	1189	1.000	1.000	Q92835.pdb.gz	SHIP1_HUMAN Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 1 OS=Homo sapiens OX=9606 GN=INPP5D PE=1 SV=2
4	AFDB:Q9ES52	0.616	0.615	0.000	1191	0.878	0.877	Q9ES52.pdb.gz	SHIP1_MOUSE Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 1 OS=Mus musculus OX=10090 GN=Inpp5d PE=1 SV=2
5	AFDB:W5U6G9	0.496	0.470	0.000	1256	0.433	0.410	W5U6G9.pdb.gz	W5U6G9_ICTPU phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase OS=Ictalurus punctatus OX=7998 GN=inppl1a PE=2 SV=1
6	AFDB:Q54PV1	0.254	0.172	2.044E-27	1800	0.144	0.095	Q54PV1.pdb.gz	Q54PV1_DICDI Inositol 5-phosphatase OS=Dictyostelium discoideum OX=44689 GN=Dd5P2 PE=4 SV=1
7	PDB:2imqX	0.207	0.811	6.985E-18	280	0.056	0.239	2imqX.pdb.gz	Heme-assisted S-nitrosation of a proximal thiolate in a nitric oxide transport protein
8	PDB:1ka6A	0.085	0.885	1.544E-10	107	0.036	0.402	1ka6A.pdb.gz	A "three-pronged" binding mechanism for the SAP/SH2D1A SH2 domain: structural basis and relevance to the XLP syndrome.
9	PDB:4f1iA	0.157	0.478	3.362E-8	328	0.032	0.116	4f1iA.pdb.gz
10	AFDB:Q57WH0	0.092	0.088	3.416E-8	1241	0.056	0.054	Q57WH0.pdb.gz	Q57WH0_TRYB2 C2 domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.28B13.500 PE=4 SV=1
11	PDB:7ax1A	0.139	0.283	1.780E-6	518	0.040	0.091	7ax1A.pdb.gz	Crystal structure and functional properties of the human CCR4-CAF1 deadenylase complex.
12	PDB:4fl2A	0.080	0.168	2.605E-6	555	0.029	0.061	4fl2A.pdb.gz	Structural and biophysical characterization of the syk activation switch.
13	PDB:4k2rA	0.081	0.172	2.904E-6	551	0.050	0.109	4k2rA.pdb.gz	Structural Basis for Activation of ZAP-70 by Phosphorylation of the SH2-Kinase Linker.
14	PDB:7kiuA	0.139	0.482	1.131E-5	263	0.040	0.183	7kiuA.pdb.gz	Structural features of Dnase1L3 responsible for serum antigen clearance.
15	PDB:1k9aB	0.077	0.203	1.331E-5	441	0.033	0.088	1k9aB.pdb.gz
16	PDB:3ps5A	0.078	0.171	2.057E-5	529	0.025	0.057	3ps5A.pdb.gz	Crystal structure of human protein tyrosine phosphatase SHP-1 in the open conformation.
17	PDB:4gwfA	0.076	0.177	2.421E-5	497	0.026	0.062	4gwfA.pdb.gz
18	AFDB:A2AP18	0.085	0.069	1.012E-4	1501	0.073	0.058	A2AP18.pdb.gz	PLCH2_MOUSE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase eta-2 OS=Mus musculus OX=10090 GN=Plch2 PE=1 SV=2
19	AFDB:O14976	0.081	0.075	3.001E-4	1311	0.071	0.064	O14976.pdb.gz	GAK_HUMAN Cyclin-G-associated kinase OS=Homo sapiens OX=9606 GN=GAK PE=1 SV=2
20	AFDB:O75038	0.089	0.076	3.169E-4	1416	0.076	0.064	O75038.pdb.gz	PLCH2_HUMAN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase eta-2 OS=Homo sapiens OX=9606 GN=PLCH2 PE=1 SV=3

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0C5A9Q6	0.0	835	1283	0.394	0.366	A0A0C5A9Q6_ICTPU phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase (Fragment) OS=Ictalurus punctatus OX=7998 PE=2 SV=1
2	A0A0C5AMM3	0.0	1170	1116	0.563	0.600	A0A0C5AMM3_ICTPU phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase OS=Ictalurus punctatus OX=7998 PE=2 SV=1
3	D7PF45	0.0	802	1260	0.365	0.344	SHIP2_PIG Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2 OS=Sus scrofa OX=9823 GN=INPPL1 PE=1 SV=2
4	H0Y5Q9	0.0	1680	810	0.681	1.000	H0Y5Q9_HUMAN Inositol polyphosphate-5-phosphatase D (Fragment) OS=Homo sapiens OX=9606 GN=INPP5D PE=1 SV=1
5	O15357	0.0	810	1258	0.368	0.348	SHIP2_HUMAN Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2 OS=Homo sapiens OX=9606 GN=INPPL1 PE=1 SV=2
6	P97573	0.0	2035	1190	0.878	0.877	SHIP1_RAT Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 1 OS=Rattus norvegicus OX=10116 GN=Inpp5d PE=1 SV=1
7	Q2I6J1	0.0	828	1266	0.388	0.364	SHP2A_DANRE Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2A OS=Danio rerio OX=7955 GN=inppl1a PE=2 SV=2
8	Q6P549	0.0	809	1257	0.365	0.345	SHIP2_MOUSE Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2 OS=Mus musculus OX=10090 GN=Inppl1 PE=1 SV=1
9	Q92835	0.0	2442	1189	1.000	1.000	SHIP1_HUMAN Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 1 OS=Homo sapiens OX=9606 GN=INPP5D PE=1 SV=2
10	Q9ES52	0.0	2020	1191	0.879	0.877	SHIP1_MOUSE Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 1 OS=Mus musculus OX=10090 GN=Inpp5d PE=1 SV=2
11	Q9WVR3	0.0	815	1257	0.373	0.352	SHIP2_RAT Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2 OS=Rattus norvegicus OX=10116 GN=Inppl1 PE=1 SV=1
12	W5U6G9	0.0	835	1256	0.394	0.373	W5U6G9_ICTPU phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase OS=Ictalurus punctatus OX=7998 GN=inppl1a PE=2 SV=1
13	W5UIG7	0.0	1169	1118	0.565	0.601	W5UIG7_ICTPU phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase OS=Ictalurus punctatus OX=7998 GN=Inpp5d PE=2 SV=1
14	Q54W40	1.24e-54	209	940	0.146	0.184	Q54W40_DICDI Inositol 5-phosphatase OS=Dictyostelium discoideum OX=44689 GN=Dd5P1 PE=4 SV=1
15	A0A0R4IPY6	3.19e-45	180	961	0.093	0.116	A0A0R4IPY6_DANRE phosphoinositide 5-phosphatase OS=Danio rerio OX=7955 GN=wu:fi09g03 PE=1 SV=1
16	F1QIY4	3.61e-45	179	953	0.093	0.116	F1QIY4_DANRE phosphoinositide 5-phosphatase OS=Danio rerio OX=7955 GN=wu:fi09g03 PE=1 SV=2
17	D3ZGS3	1.13e-42	171	902	0.093	0.123	OCRL_RAT Inositol polyphosphate 5-phosphatase OCRL OS=Rattus norvegicus OX=10116 GN=Ocrl PE=1 SV=1
18	Q01968	2.37e-42	170	901	0.095	0.125	OCRL_HUMAN Inositol polyphosphate 5-phosphatase OCRL OS=Homo sapiens OX=9606 GN=OCRL PE=1 SV=3
19	Q8I7P3	3.05e-40	163	787	0.088	0.133	Q8I7P3_DICDI Inositol 5-phosphatase 4 OS=Dictyostelium discoideum OX=44689 GN=Dd5P4 PE=3 SV=1
20	Q6NVF0	5.96e-40	162	900	0.091	0.120	OCRL_MOUSE Inositol polyphosphate 5-phosphatase OCRL OS=Mus musculus OX=10090 GN=Ocrl PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03372 Exo_endo_phos	1e-05	36.8	Endonuclease/Exonuclease/phosphatase family
2	PF00017 SH2	2.9e-12	57.8	SH2 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000405338

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000401303	0.999	SHC-transforming protein 1
2	9606.ENSP00000351497	0.998	Low affinity immunoglobulin gamma Fc region receptor II-b
3	9606.ENSP00000376345	0.991	Growth factor receptor-bound protein 2
4	9606.ENSP00000233668	0.986	Docking protein 1
5	9606.ENSP00000349477	0.966	Killer cell lectin-like receptor subfamily G member 1
6	9606.ENSP00000419085	0.963	T-cell immunoreceptor with Ig and ITIM domains
7	9606.ENSP00000411152	0.962	Inositol-trisphosphate 3-kinase B
8	9606.ENSP00000428056	0.962	Phosphatidylinositol 3-kinase regulatory subunit alpha
9	9606.ENSP00000483570	0.962	Tyrosine-protein kinase BTK
10	9606.ENSP00000340944	0.960	Tyrosine-protein phosphatase non-receptor type 11
11	9606.ENSP00000352121	0.958	Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform
12	9606.ENSP00000361021	0.957	Phosphatase and tensin homolog
13	9606.ENSP00000349727	0.956	Docking protein 3
14	9606.ENSP00000376544	0.956	B-cell antigen receptor complex-associated protein beta chain
15	9606.ENSP00000317272	0.952	Hepatocyte growth factor receptor
16	9606.ENSP00000263370	0.946	Inositol-trisphosphate 3-kinase C
17	9606.ENSP00000074304	0.944	Type I inositol 3,4-bisphosphate 4-phosphatase
18	9606.ENSP00000366563	0.943	Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform
19	9606.ENSP00000391676	0.942	Tyrosine-protein kinase JAK3
20	9606.ENSP00000289902	0.940	High affinity immunoglobulin epsilon receptor subunit gamma

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0052745	0.999	inositol phosphate phosphatase activity
GO:0034595	0.995	phosphatidylinositol phosphate 5-phosphatase activity
GO:0034594	0.977	phosphatidylinositol trisphosphate phosphatase activity
GO:0046030	0.968	inositol trisphosphate phosphatase activity
GO:0034485	0.589	phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase activity
GO:0004445	0.568	inositol-polyphosphate 5-phosphatase activity
GO:0016314	0.301	phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.988	regulation of cellular process
GO:0050896	0.985	response to stimulus
GO:0009987	0.984	cellular process
GO:0048583	0.969	regulation of response to stimulus
GO:0048518	0.966	positive regulation of biological process
GO:0023052	0.965	signaling
GO:0002682	0.962	regulation of immune system process
GO:0007165	0.960	signal transduction
GO:0002376	0.917	immune system process
GO:0050776	0.917	regulation of immune response
GO:0071704	0.911	organic substance metabolic process
GO:0002684	0.899	positive regulation of immune system process
GO:0044237	0.897	cellular metabolic process
GO:0048519	0.881	negative regulation of biological process
GO:0002757	0.851	immune response-activating signaling pathway
GO:0044238	0.846	primary metabolic process
GO:0002768	0.827	immune response-regulating cell surface receptor signaling pathway
GO:0006796	0.824	phosphate-containing compound metabolic process
GO:0048523	0.815	negative regulation of cellular process
GO:0048522	0.803	positive regulation of cellular process
GO:0019222	0.785	regulation of metabolic process
GO:0006661	0.745	phosphatidylinositol biosynthetic process
GO:0002429	0.745	immune response-activating cell surface receptor signaling pathway
GO:0051239	0.639	regulation of multicellular organismal process
GO:0060255	0.559	regulation of macromolecule metabolic process
GO:0032501	0.515	multicellular organismal process
GO:0002683	0.489	negative regulation of immune system process
GO:0009966	0.485	regulation of signal transduction
GO:0050851	0.462	antigen receptor-mediated signaling pathway
GO:0010468	0.433	regulation of gene expression
GO:0042221	0.387	response to chemical
GO:0042127	0.370	regulation of cell population proliferation
GO:0032502	0.350	developmental process
GO:0031323	0.350	regulation of cellular metabolic process
GO:0048585	0.344	negative regulation of response to stimulus
GO:0002694	0.339	regulation of leukocyte activation
GO:0080090	0.333	regulation of primary metabolic process
GO:0051171	0.332	regulation of nitrogen compound metabolic process
GO:0051240	0.315	positive regulation of multicellular organismal process
GO:0009893	0.315	positive regulation of metabolic process
GO:0048856	0.311	anatomical structure development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0016020	0.987	membrane
GO:0005886	0.977	plasma membrane
GO:0043226	0.867	organelle
GO:0043229	0.805	intracellular organelle
GO:0043231	0.700	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.1.3.-	1.000	Phosphoric monoester hydrolases.
RHEA:25528	0.589	a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-3,4,5-trisphosphate) + H2O = a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-3,4-bisphosphate) + phosphate
EC:3.1.3.56	0.568	inositol-polyphosphate 5-phosphatase.
RHEA:25017	0.301	a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-3,4,5-trisphosphate) + H2O = a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-4,5-bisphosphate) + phosphate
EC:3.1.3.67	0.301	phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase.

[back to server]