StarFunc result for job id Q92837

User Input

>input (279 residues)
MPCRREEEEEAGEEAEGEEEEEDSFLLLQQSVALGSSGEVDRLVAQIGETLQLDAAQHSP
ASPCGPPGAPLRAPGPLAAAVPADKARSPAVPLLLPPALAETVGPAPPGVLRCALGDRGR
VRGRAAPYCVAELATGPSALSPLPPQADLDGPPGAGKQGIPQPLSGPCRRGWLRGAAASR
RLQQRRGSQPETRTGDDDPHRLLQQLVLSGNLIKEAVRRLHSRRLQLRAKLPQRPLLGPL
SAPVHEPPSPRSPRAACSDPGASGRAQLRTGDGVLVPGS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q92837	1.000	1.000	3.332E-38	279	1.000	1.000	Q92837.pdb.gz	FRAT1_HUMAN Proto-oncogene FRAT1 OS=Homo sapiens OX=9606 GN=FRAT1 PE=1 SV=3
2	AFDB:P70339	0.283	0.287	1.727E-26	274	0.767	0.781	P70339.pdb.gz	FRAT1_MOUSE Proto-oncogene FRAT1 OS=Mus musculus OX=10090 GN=Frat1 PE=1 SV=2
3	AFDB:Q9WVA7	0.321	0.318	3.341E-22	283	0.685	0.675	Q9WVA7.pdb.gz	Q9WVA7_MOUSE FRAT3 OS=Mus musculus OX=10090 GN=Peg12 PE=1 SV=1
4	AFDB:Q925B0	0.108	0.097	3.773E-2	333	0.194	0.162	Q925B0.pdb.gz	PAWR_MOUSE PRKC apoptosis WT1 regulator protein OS=Mus musculus OX=10090 GN=Pawr PE=1 SV=2
5	AFDB:Q8W2F3	0.106	0.072	1.113E-1	430	0.201	0.130	Q8W2F3.pdb.gz	PIF4_ARATH Transcription factor PIF4 OS=Arabidopsis thaliana OX=3702 GN=PIF4 PE=1 SV=1
6	AFDB:Q96IZ0	0.113	0.095	1.191E-1	340	0.194	0.159	Q96IZ0.pdb.gz	PAWR_HUMAN PRKC apoptosis WT1 regulator protein OS=Homo sapiens OX=9606 GN=PAWR PE=1 SV=1
7	AFDB:A0A2R8RJR5	0.128	0.117	1.274E-1	314	0.140	0.124	A0A2R8RJR5.pdb.gz
8	AFDB:Q583Y9	0.155	0.075	1.786E-1	933	0.176	0.053	Q583Y9.pdb.gz	Q583Y9_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.2H8.600 PE=4 SV=1
9	AFDB:Q6ZNG2	0.104	0.095	2.341E-1	339	0.247	0.204	Q6ZNG2.pdb.gz	DBX2_HUMAN Homeobox protein DBX2 OS=Homo sapiens OX=9606 GN=DBX2 PE=2 SV=2
10	PDB:5oy4X	0.086	0.935	2.557E-1	25	0.086	0.960	5oy4X.pdb.gz	From PIM1 to PI3K delta via GSK3 beta : Target Hopping through the Kinome.
11	AFDB:Q6GMG1	0.114	0.055	3.758E-1	638	0.208	0.091	Q6GMG1.pdb.gz
12	PDB:5datSM	0.091	0.148	7.021	159	0.079	0.138	5datSM.pdb.gz	Coping with proline stalling: structural basis of hypusine-induced protein synthesis by the eukaryotic ribosome
13	PDB:4v88Ah	0.087	0.145	8.037	159	0.079	0.138	4v88Ah.pdb.gz	The structure of the eukaryotic ribosome at 3.0 angstrom resolution.
14	PDB:7nvnb	0.096	0.052	9.200	527	0.018	0.009	7nvnb.pdb.gz	Snapshots of actin and tubulin folding inside the TRiC chaperonin.
15	PDB:6ks6b	0.093	0.052	9.844	518	0.014	0.008	6ks6b.pdb.gz	An ensemble of cryo-EM structures of TRiC reveal its conformational landscape and subunit specificity.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q92837	0.0	526	279	1.000	1.000	FRAT1_HUMAN Proto-oncogene FRAT1 OS=Homo sapiens OX=9606 GN=FRAT1 PE=1 SV=3
2	P70339	2.31e-112	327	274	0.756	0.770	FRAT1_MOUSE Proto-oncogene FRAT1 OS=Mus musculus OX=10090 GN=Frat1 PE=1 SV=2
3	O75474	3.54e-89	266	233	0.627	0.751	FRAT2_HUMAN GSK-3-binding protein FRAT2 OS=Homo sapiens OX=9606 GN=FRAT2 PE=2 SV=3
4	Q9WVA7	1.16e-78	241	283	0.634	0.625	Q9WVA7_MOUSE FRAT3 OS=Mus musculus OX=10090 GN=Peg12 PE=1 SV=1
5	Q8K025	1.70e-55	180	231	0.487	0.589	FRAT2_MOUSE GSK-3-binding protein FRAT2 OS=Mus musculus OX=10090 GN=Frat2 PE=2 SV=1
6	O93343	1.36e-16	77.4	169	0.283	0.467	GBP_XENLA GSK-3-binding protein OS=Xenopus laevis OX=8355 GN=gbp PE=1 SV=1
7	Q9LPG3	0.37	34.7	881	0.100	0.032	MSL4_ARATH Mechanosensitive ion channel protein 4 OS=Arabidopsis thaliana OX=3702 GN=MSL4 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05350 GSK-3_bind	2.9e-134	457.4	Glycogen synthase kinase-3 binding

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000360060

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000262320	0.996	Axin-1
2	9606.ENSP00000324806	0.990	Glycogen synthase kinase-3 beta
3	9606.ENSP00000368169	0.972	Segment polarity protein dishevelled homolog DVL-1
4	9606.ENSP00000344456	0.953	Catenin beta-1
5	9606.ENSP00000257430	0.928	Adenomatous polyposis coli protein
6	9606.ENSP00000421689	0.923	Casein kinase I isoform alpha
7	9606.ENSP00000324804	0.906	Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform
8	9606.ENSP00000412324	0.905	Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit gamma isoform
9	9606.ENSP00000329117	0.903	APC membrane recruitment protein 1
10	9606.ENSP00000164133	0.902	Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit beta isoform
11	9606.ENSP00000261461	0.902	Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit alpha isoform
12	9606.ENSP00000311344	0.902	Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoform
13	9606.ENSP00000418447	0.901	Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform
14	9606.ENSP00000221138	0.900	Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform
15	9606.ENSP00000234071	0.900	Vitamin K-dependent protein C
16	9606.ENSP00000337641	0.900	Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit epsilon isoform
17	9606.ENSP00000417963	0.900	Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit delta isoform
18	9606.ENSP00000005340	0.861	Segment polarity protein dishevelled homolog DVL-2
19	9606.ENSP00000360058	0.853	GSK-3-binding protein FRAT2
20	9606.ENSP00000316054	0.849	Segment polarity protein dishevelled homolog DVL-3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0140678	1.000	molecular function inhibitor activity
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.990	cellular process
GO:0050794	0.985	regulation of cellular process
GO:0198738	0.981	cell-cell signaling by wnt
GO:0051716	0.969	cellular response to stimulus
GO:1905114	0.956	cell surface receptor signaling pathway involved in cell-cell signaling
GO:0048522	0.941	positive regulation of cellular process
GO:0016055	0.928	Wnt signaling pathway
GO:0048583	0.897	regulation of response to stimulus
GO:0048856	0.877	anatomical structure development
GO:0032879	0.873	regulation of localization
GO:0007275	0.868	multicellular organism development
GO:0009966	0.864	regulation of signal transduction
GO:0060341	0.849	regulation of cellular localization
GO:0060070	0.753	canonical Wnt signaling pathway
GO:0060828	0.740	regulation of canonical Wnt signaling pathway
GO:0032880	0.699	regulation of protein localization
GO:0071840	0.634	cellular component organization or biogenesis
GO:0016043	0.619	cellular component organization
GO:0051049	0.526	regulation of transport
GO:0032386	0.460	regulation of intracellular transport
GO:0046822	0.433	regulation of nucleocytoplasmic transport
GO:0048523	0.417	negative regulation of cellular process
GO:0071704	0.340	organic substance metabolic process
GO:0019222	0.324	regulation of metabolic process
GO:0009967	0.306	positive regulation of signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005634	1.000	nucleus
GO:0032991	0.496	protein-containing complex
GO:0016020	0.464	membrane
GO:0031981	0.338	nuclear lumen
GO:0005654	0.312	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]