StarFunc result for job id Q92838

User Input

>input (391 residues)
MGYPEVERRELLPAAAPRERGSQGCGCGGAPARAGEGNSCLLFLGFFGLSLALHLLTLCC
YLELRSELRRERGAESRLGGSGTPGTSGTLSSLGGLDPDSPITSHLGQPSPKQQPLEPGE
AALHSDSQDGHQMALLNFFFPDEKPYSEEESRRVRRNKRSKSNEGADGPVKNKKKGKKAG
PPGPNGPPGPPGPPGPQGPPGIPGIPGIPGTTVMGPPGPPGPPGPQGPPGLQGPSGAADK
AGTRENQPAVVHLQGQGSAIQVKNDLSGGVLNDWSRITMNPKVFKLHPRSGELEVLVDGT
YFIYSQVEVYYINFTDFASYEVVVDEKPFLQCTRSIETGKTNYNTCYTAGVCLLKARQKI
AVKMVHADISINMSKHTTFFGAIRLGEAPAS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O54693	0.459	0.459	2.461E-53	391	0.946	0.946	O54693.pdb.gz	EDA_MOUSE Ectodysplasin-A OS=Mus musculus OX=10090 GN=Eda PE=1 SV=2
2	AFDB:Q8MUJ1	0.286	0.271	1.383E-13	415	0.176	0.166	Q8MUJ1.pdb.gz	EIGER_DROME Protein eiger OS=Drosophila melanogaster OX=7227 GN=egr PE=1 SV=1
3	PDB:5h4bA	0.291	0.760	2.756E-7	136	0.031	0.088	5h4bA.pdb.gz
4	PDB:5kc6B	0.293	0.727	2.905E-7	144	0.020	0.056	5kc6B.pdb.gz
5	PDB:7e57B	0.249	0.708	3.587E-7	123	0.069	0.220	7e57B.pdb.gz	Atypical TNF-TNFR superfamily binding interface in the GITR-GITRL complex for T cell activation.
6	AFDB:Q5RJ80	0.295	0.133	7.011E-7	914	0.130	0.056	Q5RJ80.pdb.gz	CAPR2_DANRE Caprin-2 OS=Danio rerio OX=7955 GN=caprin2 PE=1 SV=1
7	AFDB:Q8NF64	0.135	0.071	1.709E-3	920	0.171	0.073	Q8NF64.pdb.gz	ZMIZ2_HUMAN Zinc finger MIZ domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ZMIZ2 PE=1 SV=2
8	AFDB:Q940I0	0.105	0.096	5.167E-3	439	0.113	0.100	Q940I0.pdb.gz	AHL13_ARATH AT-hook motif nuclear-localized protein 13 OS=Arabidopsis thaliana OX=3702 GN=AHL13 PE=1 SV=1
9	PDB:2waaA	0.126	0.142	9.868E-3	335	0.041	0.048	2waaA.pdb.gz
10	PDB:7l2zF	0.162	0.102	1.427E-2	664	0.026	0.015	7l2zF.pdb.gz
11	PDB:5a3oA	0.148	0.411	2.686E-2	114	0.028	0.096	5a3oA.pdb.gz	Cinnamide Derivatives of D-Mannose as Inhibitors of the Bacterial Virulence Factor Lecb from Pseudomonas Aeruginosa
12	PDB:7drtB	0.148	0.123	2.686E-2	496	0.038	0.030	7drtB.pdb.gz	Cryo-EM structure of human Wntless in complex with Wnt3a.
13	PDB:5jozA	0.122	0.100	3.684E-2	507	0.049	0.037	5jozA.pdb.gz	Structural dissection of a complex Bacteroides ovatus gene locus conferring xyloglucan metabolism in the human gut.
14	PDB:3cl5A	0.166	0.178	4.795E-2	358	0.043	0.047	3cl5A.pdb.gz	Structure of coronavirus hemagglutinin-esterase offers insight into corona and influenza virus evolution.
15	AFDB:Q6P1E1	0.134	0.062	4.980E-2	1072	0.171	0.062	Q6P1E1.pdb.gz	ZMIZ1_MOUSE Zinc finger MIZ domain-containing protein 1 OS=Mus musculus OX=10090 GN=Zmiz1 PE=1 SV=1
16	PDB:4tlgA	0.103	0.102	5.054E-2	396	0.036	0.035	4tlgA.pdb.gz	Crystal structure of SEC14-like protein 4 (SEC14L4)
17	AFDB:Q6DN12	0.170	0.086	7.202E-2	878	0.118	0.052	Q6DN12.pdb.gz	MCTP2_HUMAN Multiple C2 and transmembrane domain-containing protein 2 OS=Homo sapiens OX=9606 GN=MCTP2 PE=1 SV=3
18	AFDB:Q54DS6	0.101	0.026	9.372E-2	2221	0.136	0.024	Q54DS6.pdb.gz	Q54DS6_DICDI SH3 domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=docA PE=3 SV=1
19	AFDB:P77173	0.087	0.103	2.178E-1	328	0.110	0.131	P77173.pdb.gz	ZIPA_ECOLI Cell division protein ZipA OS=Escherichia coli (strain K12) OX=83333 GN=zipA PE=1 SV=3
20	AFDB:Q640N1	0.123	0.061	2.689E-1	1128	0.125	0.043	Q640N1.pdb.gz	AEBP1_MOUSE Adipocyte enhancer-binding protein 1 OS=Mus musculus OX=10090 GN=Aebp1 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0C4DGX3	0.0	527	259	0.662	1.000	A0A0C4DGX3_HUMAN Ectodysplasin A OS=Homo sapiens OX=9606 GN=EDA PE=1 SV=1
2	A0A0U5J797	0.0	781	389	0.995	1.000	A0A0U5J797_HUMAN Tumor necrosis factor ligand 7C OS=Homo sapiens OX=9606 GN=TNLG7C PE=2 SV=1
3	O54693	0.0	569	391	0.946	0.946	EDA_MOUSE Ectodysplasin-A OS=Mus musculus OX=10090 GN=Eda PE=1 SV=2
4	Q92838	0.0	790	391	1.000	1.000	EDA_HUMAN Ectodysplasin-A OS=Homo sapiens OX=9606 GN=EDA PE=1 SV=2
5	B0YIF1	1.98e-76	242	359	0.271	0.295	B0YIF1_DANRE Ectodysplasin OS=Danio rerio OX=7955 GN=si:ch73-223d24.5 PE=2 SV=1
6	E9PWQ3	8.96e-08	57.0	3284	0.100	0.012	E9PWQ3_MOUSE Collagen, type VI, alpha 3 OS=Mus musculus OX=10090 GN=Col6a3 PE=1 SV=2
7	A0A087WS16	1.37e-07	56.2	2677	0.100	0.015	A0A087WS16_MOUSE Collagen, type VI, alpha 3 OS=Mus musculus OX=10090 GN=Col6a3 PE=1 SV=1
8	J3QQ16	1.39e-07	56.2	2677	0.100	0.015	J3QQ16_MOUSE Collagen, type VI, alpha 3 OS=Mus musculus OX=10090 GN=Col6a3 PE=1 SV=1
9	Q6ZMJ2	1.44e-07	55.5	495	0.100	0.079	SCAR5_HUMAN Scavenger receptor class A member 5 OS=Homo sapiens OX=9606 GN=SCARA5 PE=1 SV=1
10	O88493	1.68e-07	55.8	2657	0.100	0.015	O88493_MOUSE Type VI collagen alpha 3 subunit OS=Mus musculus OX=10090 GN=Col6a3 PE=2 SV=1
11	Q9D777	2.47e-07	53.5	241	0.082	0.133	TNF13_MOUSE Tumor necrosis factor ligand superfamily member 13 OS=Mus musculus OX=10090 GN=Tnfsf13 PE=1 SV=1
12	P30204	3.10e-07	54.7	458	0.105	0.090	MSRE_MOUSE Macrophage scavenger receptor types I and II OS=Mus musculus OX=10090 GN=Msr1 PE=1 SV=3
13	Q05504	3.52e-07	54.7	959	0.100	0.041	Q05504_MOUSE Collagen alpha 3 chain type VI (Fragment) OS=Mus musculus OX=10090 GN=Col6a3 PE=2 SV=1
14	A8WG11	4.04e-07	53.1	268	0.090	0.131	A8WG11_DANRE TNF superfamily member 13b-like protein OS=Danio rerio OX=7955 GN=tnfsf13b PE=2 SV=1
15	Q6FY13	4.16e-07	54.3	794	0.074	0.037	Q6FY13_CANGA Candida glabrata strain CBS138 chromosome A complete sequence OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=CAGL0A01870g PE=3 SV=1
16	Q8K299	7.19e-07	53.5	491	0.079	0.063	SCAR5_MOUSE Scavenger receptor class A member 5 OS=Mus musculus OX=10090 GN=Scara5 PE=1 SV=1
17	O75888	7.88e-07	52.4	250	0.077	0.120	TNF13_HUMAN Tumor necrosis factor ligand superfamily member 13 OS=Homo sapiens OX=9606 GN=TNFSF13 PE=1 SV=1
18	D3ZDS2	9.74e-07	53.1	509	0.095	0.073	D3ZDS2_RAT Macrophage scavenger receptor 1 OS=Rattus norvegicus OX=10116 GN=Msr1 PE=1 SV=3
19	A0A8I6AHL9	1.22e-06	53.1	3316	0.097	0.011	A0A8I6AHL9_RAT Collagen type VI alpha 3 chain OS=Rattus norvegicus OX=10116 GN=Col6a3 PE=1 SV=1
20	A2AX52	1.24e-06	53.1	2309	0.087	0.015	CO6A4_MOUSE Collagen alpha-4(VI) chain OS=Mus musculus OX=10090 GN=Col6a4 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01391 Collagen	0.03	25.4	Collagen triple helix repeat (20 copies)
2	PF00229 TNF	5.9e-05	34.4	TNF(Tumour Necrosis Factor) family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000363680

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000258443	0.998	Tumor necrosis factor receptor superfamily member EDAR
2	9606.ENSP00000379365	0.996	Tumor necrosis factor receptor superfamily member 27
3	9606.ENSP00000358335	0.943	Mitogen-activated protein kinase kinase kinase 7
4	9606.ENSP00000335076	0.914	Ectodysplasin-A receptor-associated adapter protein
5	9606.ENSP00000352157	0.818	Mitogen-activated protein kinase 10
6	9606.ENSP00000378974	0.818	Mitogen-activated protein kinase 8
7	9606.ENSP00000258411	0.764	Protein Wnt-10a
8	9606.ENSP00000394560	0.759	Mitogen-activated protein kinase 9
9	9606.ENSP00000381070	0.743	Dual specificity mitogen-activated protein kinase kinase 7
10	9606.ENSP00000433623	0.743	TNF receptor-associated factor 6
11	9606.ENSP00000346839	0.710	Fibronectin type III domain containing
12	9606.ENSP00000350132	0.699	Cardiac phospholamban
13	9606.ENSP00000307305	0.642	DNA damage-inducible transcript 4 protein
14	9606.ENSP00000407323	0.638	Probable rRNA-processing protein EBP2
15	9606.ENSP00000312664	0.636	Caspase-2
16	9606.ENSP00000355245	0.599	Paired box protein Pax-9
17	9606.ENSP00000483552	0.598	Furin
18	9606.ENSP00000429084	0.573	E3 ubiquitin-protein ligase UBR5
19	9606.ENSP00000443410	0.554	Putative nucleotidyltransferase FAM46D
20	9606.ENSP00000301873	0.538	Latent-transforming growth factor beta-binding protein 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0048018	0.995	receptor ligand activity
GO:0005123	0.990	death receptor binding
GO:0042802	0.683	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0050794	0.997	regulation of cellular process
GO:0050896	0.993	response to stimulus
GO:0048583	0.978	regulation of response to stimulus
GO:0051716	0.970	cellular response to stimulus
GO:0048856	0.958	anatomical structure development
GO:0042476	0.951	odontogenesis
GO:0007165	0.948	signal transduction
GO:0060255	0.938	regulation of macromolecule metabolic process
GO:0010468	0.921	regulation of gene expression
GO:0007166	0.911	cell surface receptor signaling pathway
GO:0023051	0.906	regulation of signaling
GO:1902531	0.901	regulation of intracellular signal transduction
GO:0048518	0.878	positive regulation of biological process
GO:0048522	0.871	positive regulation of cellular process
GO:0042475	0.867	odontogenesis of dentin-containing tooth
GO:0080090	0.767	regulation of primary metabolic process
GO:0051171	0.763	regulation of nitrogen compound metabolic process
GO:1901222	0.751	regulation of NIK/NF-kappaB signaling
GO:0023056	0.730	positive regulation of signaling
GO:0031323	0.720	regulation of cellular metabolic process
GO:0010647	0.717	positive regulation of cell communication
GO:0009967	0.713	positive regulation of signal transduction
GO:0032501	0.712	multicellular organismal process
GO:1902533	0.682	positive regulation of intracellular signal transduction
GO:0008152	0.531	metabolic process
GO:0071704	0.521	organic substance metabolic process
GO:0019219	0.486	regulation of nucleobase-containing compound metabolic process
GO:0065009	0.481	regulation of molecular function
GO:0006355	0.463	regulation of DNA-templated transcription
GO:0043170	0.460	macromolecule metabolic process
GO:0042221	0.404	response to chemical
GO:0007275	0.393	multicellular organism development
GO:0010604	0.371	positive regulation of macromolecule metabolic process
GO:0051090	0.321	regulation of DNA-binding transcription factor activity
GO:0044093	0.319	positive regulation of molecular function
GO:0048519	0.313	negative regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0043232	0.994	intracellular non-membrane-bounded organelle
GO:0005886	0.991	plasma membrane
GO:0005737	0.889	cytoplasm
GO:0005811	0.771	lipid droplet
GO:0012505	0.581	endomembrane system
GO:0031090	0.526	organelle membrane
GO:0005829	0.457	cytosol
GO:0005634	0.419	nucleus
GO:0005783	0.369	endoplasmic reticulum
GO:0031984	0.339	organelle subcompartment
GO:0045177	0.321	apical part of cell
GO:0005856	0.318	cytoskeleton
GO:0005789	0.315	endoplasmic reticulum membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]