StarFunc result for job id Q92841

User Input

>input (729 residues)
MPTGFVAPILCVLLPSPTREAATVASATGDSASERESAAPAAAPTAEAPPPSVVTRPEPQ
ALPSPAIRAPLPDLYPFGTMRGGGFGDRDRDRDRGGFGARGGGGLPPKKFGNPGERLRKK
KWDLSELPKFEKNFYVEHPEVARLTPYEVDELRRKKEITVRGGDVCPKPVFAFHHANFPQ
YVMDVLMDQHFTEPTPIQCQGFPLALSGRDMVGIAQTGSGKTLAYLLPAIVHINHQPYLE
RGDGPICLVLAPTRELAQQVQQVADDYGKCSRLKSTCIYGGAPKGPQIRDLERGVEICIA
TPGRLIDFLESGKTNLRRCTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWP
KEVRQLAEDFLRDYTQINVGNLELSANHNILQIVDVCMESEKDHKLIQLMEEIMAEKENK
TIIFVETKRRCDDLTRRMRRDGWPAMCIHGDKSQPERDWVLNEFRSGKAPILIATDVASR
GLDVEDVKFVINYDYPNSSEDYVHRIGRTARSTNKGTAYTFFTPGNLKQARELIKVLEEA
NQAINPKLMQLVDHRGGGGGGGGRSRYRTTSSANNPNLMYQDECDRRLRGVKDGGRRDSA
SYRDRSETDRAGYANGSGYGSPNSAFGAQAGQYTYGQGTYGAAAYGTSSYTAQEYGAGTY
GASSTTSTGRSSQSSSQQFSGIGRSGQQPQPLMSQQFAQPPGATNMIGYMGQTAYQYPPP
PPPPPPSRK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A5H1ZRQ2	0.652	0.650	0.000	731	1.000	0.997	A0A5H1ZRQ2.pdb.gz	A0A5H1ZRQ2_HUMAN RNA helicase OS=Homo sapiens OX=9606 GN=DDX17 PE=1 SV=2
2	AFDB:F1Q5L6	0.626	0.738	4.011E-84	617	0.578	0.682	F1Q5L6.pdb.gz	F1Q5L6_DANRE RNA helicase OS=Danio rerio OX=7955 GN=wu:fa56a07 PE=1 SV=1
3	AFDB:Q8W4R3	0.619	0.758	2.907E-66	591	0.406	0.501	Q8W4R3.pdb.gz	RH30_ARATH DEAD-box ATP-dependent RNA helicase 30 OS=Arabidopsis thaliana OX=3702 GN=RH30 PE=1 SV=2
4	AFDB:P24782	0.603	0.795	1.001E-63	550	0.410	0.544	P24782.pdb.gz	DBP2_SCHPO ATP-dependent RNA helicase dbp2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=dbp2 PE=2 SV=2
5	AFDB:P24783	0.593	0.784	1.036E-62	546	0.398	0.531	P24783.pdb.gz	DBP2_YEAST ATP-dependent RNA helicase DBP2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DBP2 PE=1 SV=1
6	AFDB:Q26696	0.577	0.735	2.934E-52	568	0.326	0.419	Q26696.pdb.gz	DDX17_TRYBB Putative DEAD-box RNA helicase HEL64 OS=Trypanosoma brucei brucei OX=5702 GN=HEL64 PE=3 SV=1
7	AFDB:Q9P7C7	0.586	0.423	6.712E-50	1014	0.310	0.223	Q9P7C7.pdb.gz	PRP11_SCHPO Pre-mRNA-processing ATP-dependent RNA helicase prp11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=prp11 PE=1 SV=1
8	AFDB:Q9VXW2	0.584	0.351	1.175E-48	1224	0.291	0.173	Q9VXW2.pdb.gz	Q9VXW2_DROME RNA helicase OS=Drosophila melanogaster OX=7227 GN=Prp5 PE=1 SV=1
9	AFDB:Q9NXZ2	0.568	0.638	2.056E-47	648	0.265	0.298	Q9NXZ2.pdb.gz	DDX43_HUMAN Probable ATP-dependent RNA helicase DDX43 OS=Homo sapiens OX=9606 GN=DDX43 PE=1 SV=2
10	AFDB:Q86TM3	0.556	0.640	7.255E-46	631	0.261	0.301	Q86TM3.pdb.gz	DDX53_HUMAN Probable ATP-dependent RNA helicase DDX53 OS=Homo sapiens OX=9606 GN=DDX53 PE=1 SV=3
11	PDB:7evnE	0.345	0.514	1.624E-43	486	0.254	0.381	7evnE.pdb.gz	Mechanisms of the RNA helicases DDX42 and DDX46 in human U2 snRNP assembly.
12	PDB:7oqbp	0.346	0.561	4.319E-40	444	0.229	0.376	7oqbp.pdb.gz	Structural insights into how Prp5 proofreads the pre-mRNA branch site.
13	PDB:7evoE	0.306	0.484	4.215E-39	455	0.251	0.402	7evoE.pdb.gz	Structural Insights into Branch Site Proofreading by Human Spliceosome.
14	PDB:6qw65X	0.343	0.422	8.962E-34	583	0.217	0.271	6qw65X.pdb.gz	Mechanism of 5' splice site transfer for human spliceosome activation.
15	PDB:3ex7C	0.482	0.880	3.554E-32	392	0.170	0.316	3ex7C.pdb.gz	Mechanism of ATP turnover inhibition in the EJC
16	PDB:7pliA	0.470	0.741	3.086E-31	457	0.176	0.280	7pliA.pdb.gz	Structural basis for RNA-duplex unwinding by the DEAD-box helicase DbpA.
17	PDB:7pq0B	0.291	0.532	2.070E-29	385	0.173	0.327	7pq0B.pdb.gz
18	PDB:1fuuB	0.282	0.529	2.868E-28	380	0.165	0.316	1fuuB.pdb.gz
19	PDB:5zwny	0.268	0.477	1.235E-27	399	0.181	0.331	5zwny.pdb.gz	Structures of the fully assembledSaccharomyces cerevisiaespliceosome before activation
20	PDB:7oi6x	0.457	0.876	6.249E-24	374	0.158	0.307	7oi6x.pdb.gz	A distinct assembly pathway of the human 39S late pre-mitoribosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0G2JLI4	689	509	0.483	0.692	A0A0G2JLI4_HUMAN Probable ATP-dependent RNA helicase DDX5 OS=Homo sapiens OX=9606 GN=DDX5 PE=1 SV=2
2	A0A1X7SBZ2	1506	729	0.999	0.999	A0A1X7SBZ2_HUMAN RNA helicase OS=Homo sapiens OX=9606 GN=DDX17 PE=1 SV=1
3	A0A5H1ZRQ2	1503	731	1.000	0.997	A0A5H1ZRQ2_HUMAN RNA helicase OS=Homo sapiens OX=9606 GN=DDX17 PE=1 SV=2
4	A0A8I5ZKV9	800	617	0.561	0.663	A0A8I5ZKV9_RAT Probable ATP-dependent RNA helicase DDX5 OS=Rattus norvegicus OX=10116 GN=Ddx5 PE=1 SV=1
5	A0A8I5ZYB4	799	612	0.583	0.694	A0A8I5ZYB4_RAT Probable ATP-dependent RNA helicase DDX5 OS=Rattus norvegicus OX=10116 GN=Ddx5 PE=1 SV=1
6	A0A8I6G4Y3	690	478	0.483	0.736	A0A8I6G4Y3_RAT Probable ATP-dependent RNA helicase DDX5 OS=Rattus norvegicus OX=10116 GN=Ddx5 PE=1 SV=1
7	B6DTP5	811	614	0.572	0.679	B6DTP5_RAT Probable ATP-dependent RNA helicase DDX5 (Fragment) OS=Rattus norvegicus OX=10116 GN=Ddx5 PE=2 SV=1
8	F1Q5L6	801	617	0.524	0.619	F1Q5L6_DANRE RNA helicase OS=Danio rerio OX=7955 GN=wu:fa56a07 PE=1 SV=1
9	J3KTA4	801	614	0.560	0.664	J3KTA4_HUMAN Probable ATP-dependent RNA helicase DDX5 OS=Homo sapiens OX=9606 GN=DDX5 PE=1 SV=1
10	P17844	809	614	0.571	0.678	DDX5_HUMAN Probable ATP-dependent RNA helicase DDX5 OS=Homo sapiens OX=9606 GN=DDX5 PE=1 SV=1
11	P19109	583	719	0.388	0.394	DDX17_DROME ATP-dependent RNA helicase p62 OS=Drosophila melanogaster OX=7227 GN=Rm62 PE=1 SV=3
12	P24782	587	550	0.381	0.505	DBP2_SCHPO ATP-dependent RNA helicase dbp2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=dbp2 PE=2 SV=2
13	P24783	566	546	0.388	0.518	DBP2_YEAST ATP-dependent RNA helicase DBP2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DBP2 PE=1 SV=1
14	Q501J6	1338	650	0.881	0.988	DDX17_MOUSE Probable ATP-dependent RNA helicase DDX17 OS=Mus musculus OX=10090 GN=Ddx17 PE=1 SV=1
15	Q61656	818	614	0.591	0.702	DDX5_MOUSE Probable ATP-dependent RNA helicase DDX5 OS=Mus musculus OX=10090 GN=Ddx5 PE=1 SV=2
16	Q6AYI1	811	615	0.587	0.696	Q6AYI1_RAT Probable ATP-dependent RNA helicase DDX5 OS=Rattus norvegicus OX=10116 GN=Ddx5 PE=1 SV=1
17	Q6NWH7	810	496	0.534	0.784	Q6NWH7_DANRE RNA helicase OS=Danio rerio OX=7955 GN=wu:fa56a07 PE=1 SV=1
18	Q8W4R3	545	591	0.365	0.450	RH30_ARATH DEAD-box ATP-dependent RNA helicase 30 OS=Arabidopsis thaliana OX=3702 GN=RH30 PE=1 SV=2
19	Q92841	1508	729	1.000	1.000	DDX17_HUMAN Probable ATP-dependent RNA helicase DDX17 OS=Homo sapiens OX=9606 GN=DDX17 PE=1 SV=2
20	Q9XUW5	568	561	0.369	0.480	Q9XUW5_CAEEL RNA helicase OS=Caenorhabditis elegans OX=6239 GN=ddx-17 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00270 DEAD	2.7e-46	169.1	DEAD/DEAH box helicase
2	PF00210 Ferritin	5e+02	12.1	Ferritin-like domain
3	PF00271 Helicase_C	3.2e-27	106.5	Helicase conserved C-terminal domain
4	PF04851 ResIII	0.33	22.4	Type III restriction enzyme, res subunit

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000050207

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000043797	0.967	Drosha, ribonuclease type III
2	9598.ENSPTRP00000027472	0.949	DEAH (Asp-Glu-Ala-His) box polypeptide 15
3	9598.ENSPTRP00000031932	0.940	Estrogen receptor
4	9598.ENSPTRP00000024242	0.876	DiGeorge syndrome critical region gene 8
5	9598.ENSPTRP00000024841	0.869	Pan troglodytes E1A binding protein p300 (EP300), mRNA
6	9598.ENSPTRP00000000569	0.861	Heterogeneous nuclear ribonucleoprotein R
7	9598.ENSPTRP00000018825	0.853	Fibrillarin
8	9598.ENSPTRP00000025929	0.850	Guanine nucleotide binding protein-like 3 (Nucleolar)
9	9598.ENSPTRP00000014836	0.837	Cellular tumor antigen p53
10	9598.ENSPTRP00000003693	0.828	Heterogeneous nuclear ribonucleoprotein U (scaffold attachment factor A)
11	9598.ENSPTRP00000024541	0.828	Pescadillo homolog
12	9598.ENSPTRP00000025331	0.826	Belongs to the acetyltransferase family. GCN5 subfamily.
13	9598.ENSPTRP00000060659	0.825	Histone deacetylase
14	9598.ENSPTRP00000021219	0.823	RNA helicase
15	9598.ENSPTRP00000051773	0.823	DNA-directed RNA polymerase subunit beta
16	9598.ENSPTRP00000035390	0.819	Uncharacterized protein
17	9598.ENSPTRP00000005943	0.818	Myogenic factor
18	9598.ENSPTRP00000014730	0.816	Uncharacterized protein
19	9598.ENSPTRP00000038035	0.815	Pan troglodytes heterogeneous nuclear ribonucleoprotein H2 (H') (HNRNPH2), mRNA
20	9598.ENSPTRP00000039089	0.810	Required for 60S pre-ribosomal subunits export to the cytoplasm

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003723	1.000	RNA binding
GO:0005515	0.999	protein binding
GO:0003724	0.996	RNA helicase activity
GO:0003729	0.305	mRNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0050789	0.995	regulation of biological process
GO:0090304	0.991	nucleic acid metabolic process
GO:0016070	0.983	RNA metabolic process
GO:0050794	0.968	regulation of cellular process
GO:0016071	0.958	mRNA metabolic process
GO:0010467	0.950	gene expression
GO:0006396	0.932	RNA processing
GO:0000398	0.913	mRNA splicing, via spliceosome
GO:1903311	0.903	regulation of mRNA metabolic process
GO:0043484	0.860	regulation of RNA splicing
GO:0048024	0.848	regulation of mRNA splicing, via spliceosome
GO:0000381	0.817	regulation of alternative mRNA splicing, via spliceosome
GO:0048518	0.535	positive regulation of biological process
GO:0048522	0.403	positive regulation of cellular process
GO:0050896	0.393	response to stimulus
GO:0010604	0.376	positive regulation of macromolecule metabolic process
GO:0051173	0.366	positive regulation of nitrogen compound metabolic process
GO:0031325	0.366	positive regulation of cellular metabolic process
GO:0010556	0.359	regulation of macromolecule biosynthetic process
GO:0031326	0.345	regulation of cellular biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0016604	0.917	nuclear body
GO:0043232	0.887	intracellular non-membrane-bounded organelle
GO:0032991	0.821	protein-containing complex
GO:0016020	0.781	membrane
GO:0005737	0.727	cytoplasm
GO:0016607	0.691	nuclear speck
GO:0005829	0.574	cytosol
GO:0005730	0.352	nucleolus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.6.4.13	0.996	RNA helicase.

[back to server]