StarFunc result for job id Q92844

User Input

>input (425 residues)
MDKNIGEQLNKAYEAFRQACMDRDSAVKELQQKTENYEQRIREQQEQLSLQQTIIDKLKS
QLLLVNSTQDNNYGCVPLLEDSETRKNNLTLDQPQDKVISGIAREKLPKVRRQEVSSPRK
ETSARSLGSPLLHERGNIEKTFWDLKEEFHKICMLAKAQKDHLSKLNIPDTATETQCSVP
IQCTDKTDKQEALFKPQAKDDINRGAPSITSVTPRGLCRDEEDTSFESLSKFNVKFPPMD
NDSTFLHSTPERPGILSPATSEAVCQEKFNMEFRDNPGNFVKTEETLFEIQGIDPIASAI
QNLKTTDKTKPSNLVNTCIRTTLDRAACLPPGDHNALYVNSFPLLDPSDAPFPSLDSPGK
AIRGPQQPIWKPFPNQDSDSVVLSGTDSELHIPRVCEFCQAVFPPSITSRGDFLRHLNSH
FNGET

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6NW12	0.275	0.275	1.039E-57	425	0.998	0.998	Q6NW12.pdb.gz	Q6NW12_HUMAN TANK protein OS=Homo sapiens OX=9606 GN=TANK PE=1 SV=1
2	AFDB:P70347	0.194	0.186	6.735E-47	448	0.798	0.757	P70347.pdb.gz	TANK_MOUSE TRAF family member-associated NF-kappa-B activator OS=Mus musculus OX=10090 GN=Tank PE=1 SV=1
3	AFDB:A7MCY6	0.153	0.108	6.435E-4	615	0.151	0.104	A7MCY6.pdb.gz	TBKB1_HUMAN TANK-binding kinase 1-binding protein 1 OS=Homo sapiens OX=9606 GN=TBKBP1 PE=1 SV=1
4	AFDB:P37304	0.151	0.091	1.191E-3	830	0.188	0.096	P37304.pdb.gz	PAM1_YEAST Protein PAM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PAM1 PE=1 SV=2
5	AFDB:Q03088	0.152	0.081	1.275E-3	825	0.141	0.073	Q03088.pdb.gz	SVL3_YEAST Styryl dye vacuolar localization protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SVL3 PE=1 SV=1
6	AFDB:Q9ZTX8	0.075	0.036	5.742E-3	935	0.155	0.071	Q9ZTX8.pdb.gz	ARFF_ARATH Auxin response factor 6 OS=Arabidopsis thaliana OX=3702 GN=ARF6 PE=1 SV=2
7	AFDB:Q9Y6H5	0.075	0.039	9.268E-3	919	0.162	0.075	Q9Y6H5.pdb.gz	SNCAP_HUMAN Synphilin-1 OS=Homo sapiens OX=9606 GN=SNCAIP PE=1 SV=2
8	AFDB:Q59DN5	0.155	0.119	9.924E-3	618	0.148	0.102	Q59DN5.pdb.gz	Q59DN5_DROME FI18025p1 OS=Drosophila melanogaster OX=7227 GN=Sox102F PE=2 SV=1
9	AFDB:Q5JT82	0.085	0.092	1.715E-2	389	0.125	0.136	Q5JT82.pdb.gz	KLF17_HUMAN Krueppel-like factor 17 OS=Homo sapiens OX=9606 GN=KLF17 PE=1 SV=1
10	AFDB:G5EGI1	0.096	0.019	1.837E-2	2475	0.122	0.021	G5EGI1.pdb.gz	G5EGI1_CAEEL PHD-type domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=set-16 PE=1 SV=1
11	PDB:4z4kA	0.062	0.092	5.041E-1	282	0.024	0.035	4z4kA.pdb.gz	A novel mode of ubiquitin recognition by the ubiquitin-binding zinc finger domain of WRNIP1.
12	PDB:6t9lN	0.062	0.247	2.787	82	0.024	0.122	6t9lN.pdb.gz	Structure of the transcription coactivator SAGA.
13	PDB:5n5yI	0.035	0.138	5.522	99	0.014	0.061	5n5yI.pdb.gz	Structural Basis of RNA Polymerase I Transcription Initiation.
14	PDB:3j6b2	0.087	0.228	6.332	113	0.035	0.133	3j6b2.pdb.gz	Structure of the yeast mitochondrial large ribosomal subunit.
15	PDB:6yxxAf	0.067	0.143	7.260	139	0.040	0.122	6yxxAf.pdb.gz	Structural Insights into the Mechanism of Mitoribosomal Large Subunit Biogenesis.
16	PDB:4c2mI	0.035	0.113	7.774	124	0.014	0.048	4c2mI.pdb.gz	RNA Polymerase I Structure and Transcription Regulation.
17	PDB:7c4cA	0.034	0.042	8.913	332	0.009	0.012	7c4cA.pdb.gz	Structural basis for guide RNA trimming by RNase D ribonuclease in Trypanosoma brucei.
18	PDB:7od1A	0.042	0.042	8.913	430	0.014	0.014	7od1A.pdb.gz	CUL5-ARIH2 E3-E3 ubiquitin ligase structure reveals cullin-specific NEDD8 activation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E7EQA9	0.0	751	408	0.868	0.904	E7EQA9_HUMAN TRAF family member associated NFKB activator OS=Homo sapiens OX=9606 GN=TANK PE=1 SV=1
2	P70347	0.0	687	448	0.798	0.757	TANK_MOUSE TRAF family member-associated NF-kappa-B activator OS=Mus musculus OX=10090 GN=Tank PE=1 SV=1
3	Q6NW12	0.0	876	425	0.998	0.998	Q6NW12_HUMAN TANK protein OS=Homo sapiens OX=9606 GN=TANK PE=1 SV=1
4	Q92844	0.0	877	425	1.000	1.000	TANK_HUMAN TRAF family member-associated NF-kappa-B activator OS=Homo sapiens OX=9606 GN=TANK PE=1 SV=2
5	E7ENY2	1.14e-133	383	190	0.445	0.995	E7ENY2_HUMAN TRAF family member associated NFKB activator (Fragment) OS=Homo sapiens OX=9606 GN=TANK PE=1 SV=1
6	E7EVA2	4.78e-122	355	238	0.407	0.727	E7EVA2_HUMAN TRAF family member associated NFKB activator OS=Homo sapiens OX=9606 GN=TANK PE=1 SV=1
7	E7EW82	3.68e-120	351	239	0.407	0.724	E7EW82_HUMAN TRAF family member associated NFKB activator OS=Homo sapiens OX=9606 GN=TANK PE=1 SV=1
8	E7EMT6	3.64e-94	282	165	0.327	0.842	E7EMT6_HUMAN TRAF family member associated NFKB activator (Fragment) OS=Homo sapiens OX=9606 GN=TANK PE=1 SV=1
9	E7EV32	2.71e-91	273	138	0.322	0.993	E7EV32_HUMAN TRAF family member associated NFKB activator (Fragment) OS=Homo sapiens OX=9606 GN=TANK PE=1 SV=1
10	E7EWR8	1.34e-68	214	105	0.247	1.000	E7EWR8_HUMAN TRAF family member associated NFKB activator (Fragment) OS=Homo sapiens OX=9606 GN=TANK PE=1 SV=1
11	Q9QYP6	2.36e-06	52.0	405	0.118	0.123	AZI2_MOUSE 5-azacytidine-induced protein 2 OS=Mus musculus OX=10090 GN=Azi2 PE=1 SV=1
12	Q9H6S1	6.88e-05	47.4	392	0.111	0.120	AZI2_HUMAN 5-azacytidine-induced protein 2 OS=Homo sapiens OX=9606 GN=AZI2 PE=1 SV=1
13	Q5SDA5	0.27	36.2	1108	0.040	0.015	GUC2F_MOUSE Retinal guanylyl cyclase 2 OS=Mus musculus OX=10090 GN=Gucy2f PE=1 SV=1
14	P51842	1.3	33.9	1108	0.040	0.015	GUC2F_RAT Retinal guanylyl cyclase 2 OS=Rattus norvegicus OX=10116 GN=Gucy2f PE=1 SV=1
15	P51841	1.5	33.9	1108	0.040	0.015	GUC2F_HUMAN Retinal guanylyl cyclase 2 OS=Homo sapiens OX=9606 GN=GUCY2F PE=1 SV=2
16	Q9X180	3.6	32.3	755	0.059	0.033	Q9X180_THEMA histidine kinase OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=TM_1359 PE=1 SV=1
17	B3DHF2	3.7	32.3	1107	0.035	0.014	B3DHF2_DANRE Guanylate cyclase OS=Danio rerio OX=7955 GN=RETGC-1 PE=2 SV=1
18	F1QWF7	4.0	32.3	1103	0.035	0.014	F1QWF7_DANRE Guanylate cyclase OS=Danio rerio OX=7955 GN=RETGC-1 PE=3 SV=2
19	P52785	4.0	32.3	1108	0.035	0.014	GUC2E_MOUSE Retinal guanylyl cyclase 1 OS=Mus musculus OX=10090 GN=Gucy2e PE=1 SV=2
20	P51840	4.2	32.3	1108	0.035	0.014	GUC2E_RAT Retinal guanylyl cyclase 1 OS=Rattus norvegicus OX=10116 GN=Gucy2e PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12506 DUF3713	28	16.4	Protein of unknown function (DUF3713)
2	PF02465 FliD_N	68	15.6	Flagellar hook-associated protein 2 N-terminus
3	PF13887 MYRF_ICA	3.4e+02	11.8	Myelin regulatory factor ICA domain
4	PF04012 PspA_IM30	66	14.5	PspA/IM30 family
5	PF12845 TBD	6e-23	91.7	TBD domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000376505

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000329967	0.999	Serine/threonine-protein kinase TBK1
2	9606.ENSP00000362994	0.999	TNF receptor-associated factor 1
3	9606.ENSP00000454207	0.999	TNF receptor-associated factor 3
4	9606.ENSP00000483825	0.999	NF-kappa-B essential modulator
5	9606.ENSP00000464030	0.997	Inhibitor of nuclear factor kappa-B kinase subunit epsilon
6	9606.ENSP00000247668	0.991	TNF receptor-associated factor 2
7	9606.ENSP00000398698	0.991	Tumor necrosis factor
8	9606.ENSP00000362179	0.990	Endoribonuclease ZC3H12A
9	9606.ENSP00000341268	0.988	Tumor necrosis factor receptor type 1-associated DEATH domain protein
10	9606.ENSP00000162749	0.986	Tumor necrosis factor receptor superfamily member 1A
11	9606.ENSP00000401980	0.980	Mitochondrial antiviral-signaling protein
12	9606.ENSP00000259808	0.979	Receptor-interacting serine/threonine-protein kinase 1
13	9606.ENSP00000354777	0.972	TANK-binding kinase 1-binding protein 1
14	9606.ENSP00000433623	0.963	TNF receptor-associated factor 6
15	9606.ENSP00000382423	0.943	Mitogen-activated protein kinase kinase kinase 1
16	9606.ENSP00000365435	0.937	Tumor necrosis factor receptor superfamily member 1B
17	9606.ENSP00000294066	0.932	Mitogen-activated protein kinase kinase kinase kinase 2
18	9606.ENSP00000482657	0.932	Mitogen-activated protein kinase kinase kinase 14
19	9606.ENSP00000248244	0.923	TIR domain-containing adapter molecule 1
20	9606.ENSP00000471896	0.920	Interferon regulatory factor 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.421	catalytic activity
GO:0140096	0.366	catalytic activity, acting on a protein

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0065007	0.997	biological regulation
GO:0050896	0.997	response to stimulus
GO:0051716	0.994	cellular response to stimulus
GO:0050794	0.994	regulation of cellular process
GO:0023052	0.990	signaling
GO:0007154	0.990	cell communication
GO:0048518	0.978	positive regulation of biological process
GO:0048583	0.974	regulation of response to stimulus
GO:0060255	0.972	regulation of macromolecule metabolic process
GO:0007165	0.972	signal transduction
GO:0080090	0.962	regulation of primary metabolic process
GO:0051171	0.962	regulation of nitrogen compound metabolic process
GO:0009893	0.961	positive regulation of metabolic process
GO:0009966	0.960	regulation of signal transduction
GO:0010604	0.922	positive regulation of macromolecule metabolic process
GO:1902531	0.879	regulation of intracellular signal transduction
GO:0010033	0.875	response to organic substance
GO:0006950	0.815	response to stress
GO:0048519	0.783	negative regulation of biological process
GO:0051173	0.775	positive regulation of nitrogen compound metabolic process
GO:0043122	0.740	regulation of I-kappaB kinase/NF-kappaB signaling
GO:0034097	0.732	response to cytokine
GO:0044093	0.690	positive regulation of molecular function
GO:0051247	0.690	positive regulation of protein metabolic process
GO:0071310	0.662	cellular response to organic substance
GO:0048522	0.660	positive regulation of cellular process
GO:0031323	0.655	regulation of cellular metabolic process
GO:0071345	0.653	cellular response to cytokine stimulus
GO:0048523	0.652	negative regulation of cellular process
GO:0035556	0.618	intracellular signal transduction
GO:0031399	0.594	regulation of protein modification process
GO:0031401	0.541	positive regulation of protein modification process
GO:0050790	0.509	regulation of catalytic activity
GO:0010468	0.490	regulation of gene expression
GO:0034612	0.478	response to tumor necrosis factor
GO:0071356	0.464	cellular response to tumor necrosis factor
GO:0043085	0.454	positive regulation of catalytic activity
GO:0033554	0.428	cellular response to stress
GO:0045862	0.419	positive regulation of proteolysis
GO:0104004	0.417	cellular response to environmental stimulus
GO:0071214	0.412	cellular response to abiotic stimulus
GO:1903320	0.407	regulation of protein modification by small protein conjugation or removal
GO:0051345	0.387	positive regulation of hydrolase activity
GO:0048585	0.370	negative regulation of response to stimulus
GO:0009968	0.362	negative regulation of signal transduction
GO:0006974	0.333	cellular response to DNA damage stimulus
GO:0048584	0.331	positive regulation of response to stimulus
GO:0031326	0.315	regulation of cellular biosynthetic process
GO:0019219	0.315	regulation of nucleobase-containing compound metabolic process
GO:0051252	0.312	regulation of RNA metabolic process
GO:1903506	0.301	regulation of nucleic acid-templated transcription
GO:0008152	0.300	metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0032991	0.990	protein-containing complex
GO:0043226	0.502	organelle
GO:0043229	0.455	intracellular organelle
GO:0043227	0.421	membrane-bounded organelle
GO:0016020	0.420	membrane
GO:0043231	0.406	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]