StarFunc result for job id Q92845

User Input

>input (792 residues)
MQGEDARYLKRKVKGGNIDVHPSEKALIVHYEVEATILGEMGDPMLGERKECQKIIRLKS
LNANTDITSLARKVVEECKLIHPSKLNEVEQLLYYLQNRRDSLSGKEKKEKSSKPKDPPP
FEGMEIDEVANINDMDEYIELLYEDIPDKVRGSALILQLARNPDNLEELLLNETALGALA
RVLREDWKQSVELATNIIYIFFCFSSFSQFHGLITHYKIGALCMNIIDHELKRHELWQEE
LSKKKKAVDEDPENQTLRKDYEKTFKKYQGLVVKQEQLLRVALYLLLNLAEDTRTELKMR
NKNIVHMLVKALDRDNFELLILVVSFLKKLSIFMENKNDMVEMDIVEKLVKMIPCEHEDL
LNITLRLLLNLSFDTGLRNKMVQVGLLPKLTALLGNDNYKQIAMCVLYHISMDDRFKSMF
AYTDCIPQLMKMLFECSDERIDLELISFCINLAANKRNVQLICEGNGLKMLMKRALKFKD
PLLMKMIRNISQHDGPTKNLFIDYVGDLAAQISNDEEEEFVIECLGTLANLTIPDLDWEL
VLKEYKLVPYLKDKLKPGAAEDDLVLEVVIMIGTVSMDDSCAALLAKSGIIPALIELLNA
QQEDDEFVCQIIYVFYQMVFHQATRDVIIKETQAPAYLIDLMHDKNNEIRKVCDNTLDII
AEYDEEWAKKIQSEKFRWHNSQWLEMVESRQMDESEQYLYGDDRIEPYIHEGDILERPDL
FYNSDGLIASEGAISPDFFNDYHLQNGDVVGQHSFPGSLGMDGFGQPVGILGRPATAYGF
RPDEPYYYGYGS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P70188	0.922	0.921	5.993E-87	793	0.979	0.977	P70188.pdb.gz	KIFA3_MOUSE Kinesin-associated protein 3 OS=Mus musculus OX=10090 GN=Kifap3 PE=1 SV=1
2	AFDB:Q26626	0.743	0.712	4.855E-69	828	0.674	0.645	Q26626.pdb.gz	KIFA3_STRPU Kinesin-associated protein 3 OS=Strongylocentrotus purpuratus OX=7668 GN=KAP115 PE=1 SV=1
3	AFDB:Q9VZ07	0.676	0.520	3.466E-53	1038	0.472	0.360	Q9VZ07.pdb.gz	Q9VZ07_DROME Kinesin associated protein 3, isoform G OS=Drosophila melanogaster OX=7227 GN=Kap3 PE=2 SV=4
4	AFDB:Q5G8B9	0.662	0.620	1.260E-41	847	0.389	0.364	Q5G8B9.pdb.gz	Q5G8B9_CHLRE Kinesin associated protein OS=Chlamydomonas reinhardtii OX=3055 GN=KAP PE=2 SV=1
5	AFDB:G5EEE6	0.613	0.675	6.839E-34	713	0.332	0.369	G5EEE6.pdb.gz	G5EEE6_CAEEL Kinesin-associated protein OS=Caenorhabditis elegans OX=6239 GN=kap-1 PE=1 SV=2
6	AFDB:A0A2R8QDB8	0.511	0.550	1.417E-12	729	0.139	0.151	A0A2R8QDB8.pdb.gz
7	AFDB:P14923	0.507	0.536	1.785E-12	745	0.138	0.146	P14923.pdb.gz	PLAK_HUMAN Junction plakoglobin OS=Homo sapiens OX=9606 GN=JUP PE=1 SV=3
8	AFDB:Q5W041	0.422	0.390	1.785E-12	872	0.133	0.120	Q5W041.pdb.gz	ARMC3_HUMAN Armadillo repeat-containing protein 3 OS=Homo sapiens OX=9606 GN=ARMC3 PE=2 SV=2
9	AFDB:A0A2R8Y750	0.512	0.542	2.004E-12	744	0.126	0.134	A0A2R8Y750.pdb.gz	A0A2R8Y750_HUMAN Catenin beta 1 OS=Homo sapiens OX=9606 GN=CTNNB1 PE=1 SV=1
10	AFDB:P18824	0.517	0.489	4.324E-12	843	0.150	0.141	P18824.pdb.gz	ARM_DROME Armadillo segment polarity protein OS=Drosophila melanogaster OX=7227 GN=arm PE=1 SV=1
11	PDB:2z6gA	0.508	0.702	8.711E-12	550	0.114	0.164	2z6gA.pdb.gz
12	PDB:7rroH7	0.382	0.496	4.919E-11	580	0.109	0.148	7rroH7.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.
13	PDB:4r0zA	0.445	0.603	1.568E-9	557	0.107	0.153	4r0zA.pdb.gz
14	PDB:6kbnC	0.428	0.621	3.947E-9	504	0.101	0.159	6kbnC.pdb.gz	Quaternary structures of Vac8 differentially regulate the Cvt and PMN pathways.
15	PDB:5tbkA	0.376	0.658	7.974E-7	417	0.078	0.149	5tbkA.pdb.gz
16	PDB:7nscE	0.375	0.462	1.004E-6	615	0.101	0.130	7nscE.pdb.gz
17	PDB:1wa5B	0.336	0.530	1.594E-6	466	0.092	0.157	1wa5B.pdb.gz	Structural basis for the assembly of a nuclear export complex.
18	PDB:3tpoA	0.365	0.603	1.594E-6	438	0.090	0.162	3tpoA.pdb.gz
19	PDB:4tnmA	0.376	0.670	1.656E-6	407	0.088	0.172	4tnmA.pdb.gz
20	PDB:4jlqA	0.283	0.269	2.628E-6	840	0.107	0.101	4jlqA.pdb.gz	Crystal structure of human Karyopherin beta 2 bound to the PY-NLS of Saccharomyces cerevisiae Nab2.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P70188	0.0	1596	793	0.979	0.977	KIFA3_MOUSE Kinesin-associated protein 3 OS=Mus musculus OX=10090 GN=Kifap3 PE=1 SV=1
2	Q26626	0.0	1058	828	0.683	0.653	KIFA3_STRPU Kinesin-associated protein 3 OS=Strongylocentrotus purpuratus OX=7668 GN=KAP115 PE=1 SV=1
3	Q92845	0.0	1627	792	1.000	1.000	KIFA3_HUMAN Kinesin-associated protein 3 OS=Homo sapiens OX=9606 GN=KIFAP3 PE=1 SV=2
4	Q5G8B9	6.00e-148	456	847	0.319	0.299	Q5G8B9_CHLRE Kinesin associated protein OS=Chlamydomonas reinhardtii OX=3055 GN=KAP PE=2 SV=1
5	A8JUR4	7.01e-144	449	945	0.287	0.240	A8JUR4_DROME Kinesin associated protein 3, isoform H OS=Drosophila melanogaster OX=7227 GN=Kap3 PE=4 SV=2
6	B7Z139	9.73e-144	448	945	0.287	0.240	B7Z139_DROME Kinesin associated protein 3, isoform F OS=Drosophila melanogaster OX=7227 GN=Kap3 PE=4 SV=1
7	A8JUR5	3.81e-143	449	1037	0.287	0.219	A8JUR5_DROME Kinesin associated protein 3, isoform M OS=Drosophila melanogaster OX=7227 GN=Kap3 PE=4 SV=1
8	M9PGW1	3.99e-143	449	1034	0.287	0.220	M9PGW1_DROME Kinesin associated protein 3, isoform N OS=Drosophila melanogaster OX=7227 GN=Kap3 PE=4 SV=2
9	Q9VZ07	5.19e-143	449	1038	0.287	0.219	Q9VZ07_DROME Kinesin associated protein 3, isoform G OS=Drosophila melanogaster OX=7227 GN=Kap3 PE=2 SV=4
10	H2KZP1	6.34e-135	418	710	0.322	0.359	H2KZP1_CAEEL Kinesin-associated protein OS=Caenorhabditis elegans OX=6239 GN=kap-1 PE=1 SV=2
11	G5EEE6	3.92e-133	414	713	0.322	0.358	G5EEE6_CAEEL Kinesin-associated protein OS=Caenorhabditis elegans OX=6239 GN=kap-1 PE=1 SV=2
12	Q59MN0	3.13e-04	46.6	585	0.078	0.106	VAC8_CANAL Vacuolar protein 8 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=VAC8 PE=3 SV=3
13	P39968	3.39e-04	46.6	578	0.082	0.112	VAC8_YEAST Vacuolar protein 8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=VAC8 PE=1 SV=3
14	A2R3P5	0.001	44.7	576	0.080	0.109	A2R3P5_ASPNC Vacuolar protein 8 OS=Aspergillus niger (strain ATCC MYA-4892 / CBS 513.88 / FGSC A1513) OX=425011 GN=An14g05020 PE=3 SV=1
15	B7U179	0.033	40.0	737	0.059	0.064	ABAP1_ARATH ARMADILLO BTB ARABIDOPSIS PROTEIN 1 OS=Arabidopsis thaliana OX=3702 GN=ABAP1 PE=1 SV=1
16	F4IC87	0.074	39.3	920	0.035	0.030	F4IC87_ARATH Kinesin-like protein OS=Arabidopsis thaliana OX=3702 GN=ARK3 PE=1 SV=1
17	Q8NEN0	0.15	38.1	867	0.116	0.106	ARMC2_HUMAN Armadillo repeat-containing protein 2 OS=Homo sapiens OX=9606 GN=ARMC2 PE=1 SV=4
18	F4ILG6	0.28	37.4	829	0.067	0.064	F4ILG6_ARATH RING-type E3 ubiquitin transferase OS=Arabidopsis thaliana OX=3702 GN=PUB4 PE=1 SV=1
19	Q3URY6	1.4	35.0	854	0.040	0.037	ARMC2_MOUSE Armadillo repeat-containing protein 2 OS=Mus musculus OX=10090 GN=Armc2 PE=2 SV=3
20	F4HU83	1.7	34.7	915	0.034	0.030	F4HU83_ARATH Kinesin-like protein OS=Arabidopsis thaliana OX=3702 GN=ARK2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00514 Arm	9.1e-05	33.6	Armadillo/beta-catenin-like repeat
2	PF09758 FPL	8.8e+02	11.3	Uncharacterised conserved protein
3	PF02985 HEAT	7.7e+02	11.8	HEAT repeat
4	PF03581 Herpes_UL33	96	14.8	Herpesvirus UL33-like protein
5	PF05804 KAP	0	1397.8	Kinesin-associated protein (KAP)
6	PF14666 RICTOR_M	34	15.6	Rapamycin-insensitive companion of mTOR, middle domain
7	PF11698 V-ATPase_H_C	3.3e+02	12.8	V-ATPase subunit H

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000354560

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000364864	0.999	Kinesin-like protein KIF3B
2	9606.ENSP00000385808	0.999	Kinesin-like protein KIF3A
3	9606.ENSP00000264712	0.998	Kinesin-like protein KIF3C
4	9606.ENSP00000362121	0.908	Intraflagellar transport protein 52 homolog
5	9606.ENSP00000354791	0.906	Dynactin subunit 1
6	9606.ENSP00000264538	0.904	Intraflagellar transport protein 57 homolog
7	9606.ENSP00000406012	0.902	Intraflagellar transport protein 140 homolog
8	9606.ENSP00000247986	0.901	Kinesin-like protein KIF17
9	9606.ENSP00000323580	0.897	Intraflagellar transport protein 88 homolog
10	9606.ENSP00000356505	0.877	Neutrophil cytosol factor 2
11	9606.ENSP00000297814	0.875	Kinesin-like protein KIF27
12	9606.ENSP00000312778	0.869	Intraflagellar transport protein 80 homolog
13	9606.ENSP00000474032	0.868	Cytoplasmic dynein 2 light intermediate chain 1
14	9606.ENSP00000382717	0.846	WD repeat-containing protein 19
15	9606.ENSP00000393541	0.834	Intraflagellar transport protein 27 homolog
16	9606.ENSP00000386181	0.830	Tetratricopeptide repeat protein 30B
17	9606.ENSP00000408979	0.824	Kinesin heavy chain isoform 5A
18	9606.ENSP00000296266	0.822	Intraflagellar transport protein 122 homolog
19	9606.ENSP00000408910	0.813	Dynactin subunit 2
20	9606.ENSP00000242591	0.806	Intraflagellar transport protein 81 homolog

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0050794	0.988	regulation of cellular process
GO:0016043	0.985	cellular component organization
GO:0007017	0.976	microtubule-based process
GO:0051234	0.956	establishment of localization
GO:0007018	0.947	microtubule-based movement
GO:0099111	0.944	microtubule-based transport
GO:0051649	0.939	establishment of localization in cell
GO:0046907	0.898	intracellular transport
GO:0044085	0.802	cellular component biogenesis
GO:0030705	0.794	cytoskeleton-dependent intracellular transport
GO:0051640	0.769	organelle localization
GO:0022607	0.730	cellular component assembly
GO:0007154	0.643	cell communication
GO:0051656	0.547	establishment of organelle localization
GO:0010970	0.534	transport along microtubule
GO:0048518	0.376	positive regulation of biological process
GO:0006996	0.371	organelle organization
GO:0050896	0.356	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005929	0.999	cilium
GO:0005871	0.999	kinesin complex
GO:0005829	0.998	cytosol
GO:0005815	0.988	microtubule organizing center
GO:0043231	0.945	intracellular membrane-bounded organelle
GO:0012505	0.939	endomembrane system
GO:0005813	0.911	centrosome
GO:0016020	0.904	membrane
GO:0005634	0.893	nucleus
GO:0070013	0.858	intracellular organelle lumen
GO:0031981	0.814	nuclear lumen
GO:0097542	0.803	ciliary tip
GO:0016939	0.603	kinesin II complex
GO:0005783	0.516	endoplasmic reticulum
GO:0071944	0.496	cell periphery
GO:0005654	0.490	nucleoplasm
GO:0035869	0.448	ciliary transition zone
GO:0097730	0.439	non-motile cilium
GO:0099568	0.415	cytoplasmic region
GO:0099080	0.400	supramolecular complex
GO:0005886	0.384	plasma membrane
GO:0099512	0.375	supramolecular fiber
GO:0032838	0.362	plasma membrane bounded cell projection cytoplasm
GO:0099513	0.355	polymeric cytoskeletal fiber
GO:0005819	0.351	spindle
GO:0005874	0.350	microtubule
GO:0005930	0.350	axoneme
GO:0005694	0.323	chromosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]