StarFunc result for job id Q92847

User Input

>input (366 residues)
MWNATPSEEPGFNLTLADLDWDASPGNDSLGDELLQLFPAPLLAGVTATCVALFVVGIAG
NLLTMLVVSRFRELRTTTNLYLSSMAFSDLLIFLCMPLDLVRLWQYRPWNFGDLLCKLFQ
FVSESCTYATVLTITALSVERYFAICFPLRAKVVVTKGRVKLVIFVIWAVAFCSAGPIFV
LVGVEHENGTDPWDTNECRPTEFAVRSGLLTVMVWVSSIFFFLPVFCLTVLYSLIGRKLW
RRRRGDAVVGASLRDQNHKQTVKMLAVVVFAFILCWLPFHVGRYLFSKSFEPGSLEIAQI
SQYCNLVSFVLFYLSAAINPILYNIMSKKYRVAVFRLLGFEPFSQRKLSTLKDESSRAWT
ESSINT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q92847	1.000	1.000	8.607E-51	366	1.000	1.000	Q92847.pdb.gz	GHSR_HUMAN Growth hormone secretagogue receptor type 1 OS=Homo sapiens OX=9606 GN=GHSR PE=1 SV=1
2	AFDB:E7EZL2	0.852	0.855	4.313E-37	365	0.664	0.666	E7EZL2.pdb.gz	E7EZL2_DANRE Growth hormone secretagogue receptor b OS=Danio rerio OX=7955 GN=ghsrb PE=3 SV=1
3	AFDB:B0V1I9	0.851	0.865	7.406E-37	360	0.650	0.661	B0V1I9.pdb.gz	B0V1I9_DANRE Growth hormone secretagogue receptor a OS=Danio rerio OX=7955 GN=si:ch211-244m8.1 PE=3 SV=1
4	AFDB:C7G181	0.839	0.867	1.908E-36	354	0.699	0.723	C7G181.pdb.gz	C7G181_COTJA Growth hormone secretagogue-receptor 1a-L OS=Coturnix japonica OX=93934 GN=GHS-R PE=2 SV=1
5	PDB:7w2zR	0.769	0.928	2.152E-33	301	0.820	0.997	7w2zR.pdb.gz	Molecular mechanism of agonism and inverse agonism in ghrelin receptor.
6	AFDB:A8CGH1	0.815	0.772	5.508E-31	387	0.566	0.535	A8CGH1.pdb.gz	A8CGH1_ONCMY Growth hormone secretagogue receptor 1a OS=Oncorhynchus mykiss OX=8022 GN=GHS-R PE=2 SV=1
7	AFDB:O43193	0.790	0.704	2.621E-26	412	0.481	0.427	O43193.pdb.gz	MTLR_HUMAN Motilin receptor OS=Homo sapiens OX=9606 GN=MLNR PE=1 SV=1
8	AFDB:A0A286YBK1	0.770	0.721	8.624E-20	392	0.331	0.309	A0A286YBK1.pdb.gz	A0A286YBK1_DANRE Neuromedin U receptor 3 OS=Danio rerio OX=7955 GN=nmur3 PE=3 SV=1
9	AFDB:Q8ITC7	0.803	0.625	9.873E-20	477	0.298	0.229	Q8ITC7.pdb.gz	CAPAR_DROME Neuropeptides capa receptor OS=Drosophila melanogaster OX=7227 GN=CapaR PE=2 SV=3
10	AFDB:Q8ITC9	0.767	0.657	1.416E-19	430	0.309	0.263	Q8ITC9.pdb.gz	PK1R_DROME Pyrokinin-1 receptor OS=Drosophila melanogaster OX=7227 GN=PK1-R PE=2 SV=1
11	AFDB:Q8BZ39	0.765	0.710	2.030E-19	395	0.287	0.266	Q8BZ39.pdb.gz	NMUR2_MOUSE Neuromedin-U receptor 2 OS=Mus musculus OX=10090 GN=Nmur2 PE=2 SV=1
12	PDB:7w55R	0.721	0.861	4.522E-17	303	0.273	0.330	7w55R.pdb.gz	Structural insights into the peptide selectivity and activation of human neuromedin U receptors.
13	PDB:6osaR	0.757	0.858	1.395E-16	321	0.295	0.336	6osaR.pdb.gz	Conformational transitions of a neurotensin receptor 1-Gi1complex.
14	PDB:4xesA	0.714	0.561	4.304E-16	471	0.290	0.225	4xesA.pdb.gz	Structural prerequisites for G-protein activation by the neurotensin receptor.
15	PDB:7w56R	0.655	0.852	2.731E-15	276	0.287	0.380	7w56R.pdb.gz	Structural insights into the peptide selectivity and activation of human neuromedin U receptors.
16	PDB:7w53R	0.638	0.868	9.604E-14	264	0.276	0.383	7w53R.pdb.gz	Structural insights into the peptide selectivity and activation of human neuromedin U receptors.
17	PDB:7mbyR	0.650	0.827	1.725E-13	283	0.221	0.286	7mbyR.pdb.gz	Structures of the human cholecystokinin 1 (CCK1) receptor bound to Gs and Gq mimetic proteins provide insight into mechanisms of G protein selectivity.
18	PDB:7wicR	0.663	0.826	1.805E-13	288	0.197	0.250	7wicR.pdb.gz	Structures of the endogenous peptide- and selective non-peptide agonist-bound SSTR2 signaling complexes.
19	PDB:7wq3R	0.686	0.857	5.323E-13	289	0.186	0.235	7wq3R.pdb.gz	Molecular basis for allosteric agonism and G protein subtype selectivity of galanin receptors
20	PDB:8ef5M	0.643	0.801	5.568E-13	288	0.205	0.260	8ef5M.pdb.gz	Molecular recognition of morphine and fentanyl by the human mu-opioid receptor.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B0V1I9	0.0	508	360	0.661	0.672	B0V1I9_DANRE Growth hormone secretagogue receptor a OS=Danio rerio OX=7955 GN=si:ch211-244m8.1 PE=3 SV=1
2	C7G181	0.0	555	354	0.716	0.740	C7G181_COTJA Growth hormone secretagogue-receptor 1a-L OS=Coturnix japonica OX=93934 GN=GHS-R PE=2 SV=1
3	C7G182	0.0	554	347	0.716	0.755	C7G182_COTJA Growth hormone secretagogue receptor OS=Coturnix japonica OX=93934 GN=GHS-R PE=2 SV=1
4	O08725	0.0	678	364	0.956	0.962	GHSR_RAT Growth hormone secretagogue receptor type 1 OS=Rattus norvegicus OX=10116 GN=Ghsr PE=2 SV=1
5	Q92847	0.0	745	366	1.000	1.000	GHSR_HUMAN Growth hormone secretagogue receptor type 1 OS=Homo sapiens OX=9606 GN=GHSR PE=1 SV=1
6	Q95254	0.0	676	366	0.932	0.932	GHSR_PIG Growth hormone secretagogue receptor type 1 OS=Sus scrofa OX=9823 GN=GHSR PE=2 SV=1
7	Q99P50	0.0	678	364	0.954	0.959	GHSR_MOUSE Growth hormone secretagogue receptor type 1 OS=Mus musculus OX=10090 GN=Ghsr PE=2 SV=3
8	E7EZL2	6.48e-174	490	365	0.658	0.660	E7EZL2_DANRE Growth hormone secretagogue receptor b OS=Danio rerio OX=7955 GN=ghsrb PE=3 SV=1
9	A8CGH1	1.33e-149	429	387	0.593	0.561	A8CGH1_ONCMY Growth hormone secretagogue receptor 1a OS=Oncorhynchus mykiss OX=8022 GN=GHS-R PE=2 SV=1
10	A8CGH2	2.79e-149	428	387	0.590	0.558	A8CGH2_ONCMY Growth hormone secretagogue receptor 1a variant OS=Oncorhynchus mykiss OX=8022 GN=GHS-R PE=2 SV=1
11	A8CGH3	2.61e-106	316	300	0.426	0.520	A8CGH3_ONCMY Growth hormone secretagogue receptor 1b OS=Oncorhynchus mykiss OX=8022 GN=GHS-R PE=2 SV=1
12	A8CGH5	6.58e-106	315	297	0.423	0.522	A8CGH5_ONCMY Growth hormone secretagogue receptor 1b variant OS=Oncorhynchus mykiss OX=8022 GN=GHS-R PE=3 SV=1
13	O43193	1.63e-96	295	412	0.492	0.437	MTLR_HUMAN Motilin receptor OS=Homo sapiens OX=9606 GN=MLNR PE=1 SV=1
14	A0A286YBK1	1.31e-53	183	392	0.333	0.311	A0A286YBK1_DANRE Neuromedin U receptor 3 OS=Danio rerio OX=7955 GN=nmur3 PE=3 SV=1
15	Q8BZ39	1.83e-45	162	395	0.287	0.266	NMUR2_MOUSE Neuromedin-U receptor 2 OS=Mus musculus OX=10090 GN=Nmur2 PE=2 SV=1
16	Q9ESQ4	2.46e-45	162	395	0.279	0.258	NMUR2_RAT Neuromedin-U receptor 2 OS=Rattus norvegicus OX=10116 GN=Nmur2 PE=1 SV=2
17	Q8ITC7	9.75e-44	159	477	0.298	0.229	CAPAR_DROME Neuropeptides capa receptor OS=Drosophila melanogaster OX=7227 GN=CapaR PE=2 SV=3
18	P30989	6.40e-43	155	418	0.301	0.263	NTR1_HUMAN Neurotensin receptor type 1 OS=Homo sapiens OX=9606 GN=NTSR1 PE=1 SV=2
19	O88319	7.42e-43	155	424	0.309	0.267	NTR1_MOUSE Neurotensin receptor type 1 OS=Mus musculus OX=10090 GN=Ntsr1 PE=1 SV=1
20	O55040	8.18e-43	155	428	0.317	0.271	NMUR1_MOUSE Neuromedin-U receptor 1 OS=Mus musculus OX=10090 GN=Nmur1 PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00001 7tm_1	3.2e-51	185.7	7 transmembrane receptor (rhodopsin family)
2	PF13853 7tm_4	1.4	20.2	Olfactory receptor
3	PF10320 7TM_GPCR_Srsx	0.0034	28.4	Serpentine type 7TM GPCR chemoreceptor Srsx
4	PF10323 7TM_GPCR_Srv	0.0026	28.7	Serpentine type 7TM GPCR chemoreceptor Srv
5	PF10324 7TM_GPCR_Srw	3.3e-07	41.5	Serpentine type 7TM GPCR chemoreceptor Srw
6	PF10328 7TM_GPCR_Srx	0.41	21.8	Serpentine type 7TM GPCR chemoreceptor Srx

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000241256

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000335074	0.998	Appetite-regulating hormone
2	9606.ENSP00000366248	0.978	Cortistatin
3	9606.ENSP00000286548	0.945	Guanine nucleotide-binding protein G(q) subunit alpha
4	9606.ENSP00000314196	0.941	Ghrelin O-acyltransferase
5	9606.ENSP00000287641	0.916	Somatostatin
6	9606.ENSP00000243911	0.914	Melanocortin receptor 3
7	9606.ENSP00000384364	0.907	Pro-neuropeptide Y
8	9606.ENSP00000078429	0.862	Guanine nucleotide-binding protein subunit alpha-11
9	9606.ENSP00000290953	0.803	Agouti-related protein
10	9606.ENSP00000362716	0.801	Somatoliberin
11	9606.ENSP00000388825	0.778	Promotilin
12	9606.ENSP00000276414	0.751	Progonadoliberin-1
13	9606.ENSP00000312652	0.730	Leptin
14	9606.ENSP00000217386	0.719	Oxytocin-neurophysin 1
15	9606.ENSP00000293330	0.710	Orexin
16	9606.ENSP00000264218	0.691	Neuromedin-U
17	9606.ENSP00000330393	0.677	Leptin receptor
18	9606.ENSP00000384092	0.677	Pro-opiomelanocortin
19	9606.ENSP00000483403	0.674	Growth hormone receptor
20	9606.ENSP00000320180	0.669	Growth hormone-releasing hormone receptor

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004930	1.000	G protein-coupled receptor activity
GO:0005488	0.997	binding
GO:0005515	0.986	protein binding
GO:0008528	0.953	G protein-coupled peptide receptor activity
GO:0005102	0.366	signaling receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.997	regulation of biological process
GO:0051716	0.996	cellular response to stimulus
GO:0023052	0.995	signaling
GO:0007154	0.995	cell communication
GO:0050794	0.993	regulation of cellular process
GO:0009719	0.983	response to endogenous stimulus
GO:0007165	0.981	signal transduction
GO:0007186	0.941	G protein-coupled receptor signaling pathway
GO:0071495	0.906	cellular response to endogenous stimulus
GO:0042221	0.882	response to chemical
GO:0032870	0.861	cellular response to hormone stimulus
GO:0048518	0.617	positive regulation of biological process
GO:0032501	0.580	multicellular organismal process
GO:0048522	0.523	positive regulation of cellular process
GO:0019222	0.413	regulation of metabolic process
GO:0060255	0.388	regulation of macromolecule metabolic process
GO:0065008	0.367	regulation of biological quality
GO:0048519	0.347	negative regulation of biological process
GO:0032502	0.319	developmental process
GO:0051239	0.306	regulation of multicellular organismal process
GO:0048583	0.304	regulation of response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.996	plasma membrane
GO:0005622	0.834	intracellular anatomical structure
GO:0043231	0.761	intracellular membrane-bounded organelle
GO:0005737	0.463	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]