StarFunc result for job id Q92851

User Input

>input (521 residues)
MKSQGQHWYSSSDKNCKVSFREKLLIIDSNLGVQDVENLKFLCIGLVPNKKLEKSSSASD
VFEHLLAEDLLSEEDPFFLAELLYIIRQKKLLQHLNCTKEEVERLLPTRQRVSLFRNLLY
ELSEGIDSENLKDMIFLLKDSLPKTEMTSLSFLAFLEKQGKIDEDNLTCLEDLCKTVVPK
LLRNIEKYKREKAIQIVTPPVDKEAESYQGEEELVSQTDVKTFLEALPQESWQNKHAGSN
GNRATNGAPSLVSRGMQGASANTLNSETSTKRAAVYRMNRNHRGLCVIVNNHSFTSLKDR
QGTHKDAEILSHVFQWLGFTVHIHNNVTKVEMEMVLQKQKCNPAHADGDCFVFCILTHGR
FGAVYSSDEALIPIREIMSHFTALQCPRLAEKPKLFFIQACQGEEIQPSVSIEADALNPE
QAPTSLQDSIPAEADFLLGLATVPGYVSFRHVEEGSWYIQSLCNHLKKLVPRMLKFLEKT
MEIRGRKRTVWGAKQISATSLPTAISAQTPRPPMRRWSSVS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q92851	1.000	1.000	1.806E-99	521	1.000	1.000	Q92851.pdb.gz	CASPA_HUMAN Caspase-10 OS=Homo sapiens OX=9606 GN=CASP10 PE=1 SV=3
2	AFDB:Q14790	0.367	0.397	2.005E-37	479	0.315	0.342	Q14790.pdb.gz	CASP8_HUMAN Caspase-8 OS=Homo sapiens OX=9606 GN=CASP8 PE=1 SV=1
3	AFDB:Q9JHX4	0.350	0.378	1.156E-35	482	0.315	0.340	Q9JHX4.pdb.gz	CASP8_RAT Caspase-8 OS=Rattus norvegicus OX=10116 GN=Casp8 PE=1 SV=1
4	AFDB:O89110	0.375	0.406	4.213E-35	480	0.305	0.331	O89110.pdb.gz	CASP8_MOUSE Caspase-8 OS=Mus musculus OX=10090 GN=Casp8 PE=1 SV=1
5	AFDB:A0A2U9DQK9	0.339	0.368	5.218E-33	477	0.296	0.323	A0A2U9DQK9.pdb.gz
6	AFDB:G3IL63	0.352	0.592	5.595E-23	303	0.171	0.294	G3IL63.pdb.gz	G3IL63_CRIGR Caspase-7 OS=Cricetulus griseus OX=10029 GN=I79_024625 PE=1 SV=1
7	AFDB:C0H5Y5	0.323	0.348	1.201E-22	480	0.205	0.223	C0H5Y5.pdb.gz	C0H5Y5_RAT CASP8 and FADD-like apoptosis regulator OS=Rattus norvegicus OX=10116 GN=Cflar PE=3 SV=1
8	AFDB:O15519	0.305	0.329	2.579E-22	480	0.223	0.242	O15519.pdb.gz	CFLAR_HUMAN CASP8 and FADD-like apoptosis regulator OS=Homo sapiens OX=9606 GN=CFLAR PE=1 SV=1
9	AFDB:Q4ZHV0	0.335	0.610	4.127E-22	279	0.146	0.272	Q4ZHV0.pdb.gz	Q4ZHV0_SALSA Caspase 3B OS=Salmo salar OX=8030 GN=CASP3 PE=2 SV=1
10	AFDB:P55210	0.346	0.585	5.871E-22	303	0.177	0.304	P55210.pdb.gz	CASP7_HUMAN Caspase-7 OS=Homo sapiens OX=9606 GN=CASP7 PE=1 SV=1
11	PDB:4fdlB	0.347	0.739	2.602E-19	239	0.148	0.322	4fdlB.pdb.gz
12	PDB:4pryA	0.345	0.709	2.602E-19	249	0.132	0.277	4pryA.pdb.gz	Selective inhibition of initiator versus executioner caspases using small peptides containing unnatural amino acids.
13	PDB:4nblA	0.333	0.648	3.586E-16	258	0.150	0.302	4nblA.pdb.gz	Tailoring small molecules for an allosteric site on procaspase-6.
14	PDB:7wzsB	0.290	0.712	1.542E-14	206	0.132	0.335	7wzsB.pdb.gz
15	PDB:4iyrB	0.274	0.721	1.061E-12	191	0.117	0.319	4iyrB.pdb.gz
16	PDB:2wdpD	0.280	0.603	7.378E-12	230	0.125	0.283	2wdpD.pdb.gz
17	PDB:5jqeA	0.316	0.303	1.028E-9	544	0.107	0.103	5jqeA.pdb.gz
18	PDB:2bbzA	0.289	0.738	1.576E-5	190	0.077	0.211	2bbzA.pdb.gz
19	PDB:6p6cA	0.130	0.613	1.717E-2	90	0.038	0.222	6p6cA.pdb.gz
20	PDB:6w8rA	0.183	0.252	3.475E-2	364	0.038	0.055	6w8rA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q92851	0.0	1084	521	1.000	1.000	CASPA_HUMAN Caspase-10 OS=Homo sapiens OX=9606 GN=CASP10 PE=1 SV=3
2	Q14790	7.76e-73	241	479	0.317	0.344	CASP8_HUMAN Caspase-8 OS=Homo sapiens OX=9606 GN=CASP8 PE=1 SV=1
3	O89110	2.59e-70	234	480	0.311	0.338	CASP8_MOUSE Caspase-8 OS=Mus musculus OX=10090 GN=Casp8 PE=1 SV=1
4	Q9JHX4	4.03e-70	234	482	0.319	0.344	CASP8_RAT Caspase-8 OS=Rattus norvegicus OX=10116 GN=Casp8 PE=1 SV=1
5	Q66I19	3.78e-63	215	476	0.322	0.353	Q66I19_DANRE Caspase 8, apoptosis-related cysteine peptidase OS=Danio rerio OX=7955 GN=zgc:92075 PE=1 SV=1
6	P97864	6.93e-44	159	303	0.157	0.271	CASP7_MOUSE Caspase-7 OS=Mus musculus OX=10090 GN=Casp7 PE=1 SV=2
7	P55210	4.43e-43	157	303	0.159	0.274	CASP7_HUMAN Caspase-7 OS=Homo sapiens OX=9606 GN=CASP7 PE=1 SV=1
8	A0A0G2K9Z4	7.05e-43	156	291	0.154	0.275	A0A0G2K9Z4_RAT Caspase 7 OS=Rattus norvegicus OX=10116 GN=Casp7 PE=1 SV=1
9	A0A8I5ZQU7	2.03e-42	155	301	0.146	0.252	A0A8I5ZQU7_RAT Caspase 7 OS=Rattus norvegicus OX=10116 GN=Casp7 PE=3 SV=1
10	G3IL63	9.38e-42	153	303	0.148	0.254	G3IL63_CRIGR Caspase-7 OS=Cricetulus griseus OX=10029 GN=I79_024625 PE=1 SV=1
11	F1NV61	4.48e-40	149	309	0.152	0.256	CASP7_CHICK Caspase-7 OS=Gallus gallus OX=9031 GN=CASP7 PE=3 SV=2
12	H7C0E2	9.29e-40	147	258	0.152	0.306	H7C0E2_HUMAN Caspase-8 (Fragment) OS=Homo sapiens OX=9606 GN=CASP8 PE=1 SV=1
13	O02002	9.51e-40	148	323	0.167	0.269	CASP1_DROME Caspase-1 OS=Drosophila melanogaster OX=7227 GN=Dcp-1 PE=1 SV=1
14	O01382	4.89e-38	144	339	0.159	0.245	DRICE_DROME Caspase OS=Drosophila melanogaster OX=7227 GN=Drice PE=1 SV=2
15	O93417	1.11e-37	142	283	0.163	0.300	O93417_CHICK Caspase-3 OS=Gallus gallus OX=9031 GN=CASP3 PE=1 SV=1
16	H0Z8H6	5.73e-37	140	282	0.152	0.280	H0Z8H6_TAEGU Caspase 3 OS=Taeniopygia guttata OX=59729 GN=CASP3 PE=3 SV=2
17	Q98UI8	9.51e-36	136	282	0.144	0.266	Q98UI8_DANRE Caspase 3, apoptosis-related cysteine peptidase a OS=Danio rerio OX=7955 GN=casp3 PE=1 SV=1
18	Q4ZHV0	4.11e-34	132	279	0.155	0.290	Q4ZHV0_SALSA Caspase 3B OS=Salmo salar OX=8030 GN=CASP3 PE=2 SV=1
19	P70677	7.47e-34	131	277	0.154	0.289	CASP3_MOUSE Caspase-3 OS=Mus musculus OX=10090 GN=Casp3 PE=1 SV=1
20	P55213	2.15e-33	130	277	0.161	0.303	CASP3_RAT Caspase-3 OS=Rattus norvegicus OX=10116 GN=Casp3 PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01335 DED	2.2e-35	132.0	Death effector domain
2	PF15565 Imm30	3.7	19.0	Immunity protein 30
3	PF00656 Peptidase_C14	2.7e-32	124.0	Caspase domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_008972421.1

Rank	PPI partner	STRING score	Description
1	9597.XP_008952492.1	0.999	FAS-associated death domain protein
2	9597.XP_003812258.1	0.990	TNFRSF1A associated via death domain
3	9597.XP_008972417.1	0.988	CASP8 and FADD-like apoptosis regulator isoform X1
4	9597.XP_003820792.1	0.986	Belongs to the peptidase C14A family.
5	9597.XP_003828341.1	0.983	Counters the protective effect of Bcl-2.
6	9597.XP_008961098.1	0.966	Fas cell surface death receptor
7	9597.XP_003823509.1	0.963	Belongs to the peptidase C14A family.
8	9597.XP_008970906.1	0.953	Receptor interacting serine/threonine kinase 1
9	9597.XP_003825650.1	0.945	Belongs to the peptidase C14A family.
10	9597.XP_003832655.1	0.938	Oligomeric Apaf-1 mediates the cytochrome c-dependent autocatalytic activation of pro-caspase-9 (Apaf-3), leading to the activation of caspase-3 and apoptosis. This activation requires ATP.
11	9597.XP_008955558.1	0.928	Tumor necrosis factor ligand superfamily member 10 isoform X1
12	9597.XP_003809147.1	0.927	Receptor interacting serine/threonine kinase 3
13	9597.XP_008968343.1	0.915	TNF receptor-associated factor 2 isoform X1
14	9597.XP_003824715.1	0.906	Belongs to the tumor necrosis factor family.
15	9597.XP_003823634.1	0.895	TNF receptor superfamily member 10b
16	9597.XP_008971992.1	0.895	TNF receptor superfamily member 1A
17	9597.XP_003823628.1	0.889	TNF receptor superfamily member 10a
18	9597.XP_003823629.1	0.848	Tumor necrosis factor receptor superfamily member 10D
19	9597.XP_008953209.1	0.843	FAS-associated factor 1
20	9597.XP_003833145.1	0.832	TNF receptor associated factor 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019904	1.000	protein domain specific binding
GO:0097153	1.000	cysteine-type endopeptidase activity involved in apoptotic process
GO:0031625	0.997	ubiquitin protein ligase binding
GO:0042802	0.322	identical protein binding
GO:0097199	0.311	cysteine-type endopeptidase activity involved in apoptotic signaling pathway

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0050794	0.992	regulation of cellular process
GO:0048518	0.991	positive regulation of biological process
GO:0048522	0.984	positive regulation of cellular process
GO:0008219	0.973	cell death
GO:0006915	0.961	apoptotic process
GO:0009967	0.928	positive regulation of signal transduction
GO:0043122	0.922	regulation of I-kappaB kinase/NF-kappaB signaling
GO:0043123	0.914	positive regulation of I-kappaB kinase/NF-kappaB signaling
GO:0050896	0.809	response to stimulus
GO:0051716	0.729	cellular response to stimulus
GO:0019222	0.677	regulation of metabolic process
GO:0010941	0.667	regulation of cell death
GO:0043067	0.555	regulation of programmed cell death
GO:0042981	0.535	regulation of apoptotic process
GO:0060255	0.533	regulation of macromolecule metabolic process
GO:0080090	0.528	regulation of primary metabolic process
GO:0051171	0.528	regulation of nitrogen compound metabolic process
GO:0071704	0.446	organic substance metabolic process
GO:0044238	0.437	primary metabolic process
GO:0007154	0.435	cell communication
GO:0007165	0.417	signal transduction
GO:0006807	0.411	nitrogen compound metabolic process
GO:0043170	0.374	macromolecule metabolic process
GO:0010942	0.371	positive regulation of cell death
GO:0065009	0.365	regulation of molecular function
GO:0009893	0.351	positive regulation of metabolic process
GO:0006950	0.348	response to stress
GO:0051246	0.347	regulation of protein metabolic process
GO:0010604	0.338	positive regulation of macromolecule metabolic process
GO:0042221	0.337	response to chemical
GO:0019538	0.311	protein metabolic process
GO:0048519	0.308	negative regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0032991	0.999	protein-containing complex
GO:0016020	0.999	membrane
GO:0005886	0.991	plasma membrane
GO:0043226	0.948	organelle
GO:0043229	0.920	intracellular organelle
GO:0043231	0.911	intracellular membrane-bounded organelle
GO:0098796	0.879	membrane protein complex
GO:1902494	0.739	catalytic complex
GO:0005634	0.714	nucleus
GO:0098797	0.687	plasma membrane protein complex
GO:0031264	0.339	death-inducing signaling complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.22.-	1.000	Cysteine endopeptidases.

[back to server]