StarFunc result for job id Q92854

User Input

>input (862 residues)
MRMCTPIRGLLMALAVMFGTAMAFAPIPRITWEHREVHLVQFHEPDIYNYSALLLSEDKD
TLYIGAREAVFAVNALNISEKQHEVYWKVSEDKKAKCAEKGKSKQTECLNYIRVLQPLSA
TSLYVCGTNAFQPACDHLNLTSFKFLGKNEDGKGRCPFDPAHSYTSVMVDGELYSGTSYN
FLGSEPIISRNSSHSPLRTEYAIPWLNEPSFVFADVIRKSPDSPDGEDDRVYFFFTEVSV
EYEFVFRVLIPRIARVCKGDQGGLRTLQKKWTSFLKARLICSRPDSGLVFNVLRDVFVLR
SPGLKVPVFYALFTPQLNNVGLSAVCAYNLSTAEEVFSHGKYMQSTTVEQSHTKWVRYNG
PVPKPRPGACIDSEARAANYTSSLNLPDKTLQFVKDHPLMDDSVTPIDNRPRLIKKDVNY
TQIVVDRTQALDGTVYDVMFVSTDRGALHKAISLEHAVHIIEETQLFQDFEPVQTLLLSS
KKGNRFVYAGSNSGVVQAPLAFCGKHGTCEDCVLARDPYCAWSPPTATCVALHQTESPSR
GLIQEMSGDASVCPDKSKGSYRQHFFKHGGTAELKCSQKSNLARVFWKFQNGVLKAESPK
YGLMGRKNLLIFNLSEGDSGVYQCLSEERVKNKTVFQVVAKHVLEVKVVPKPVVAPTLSV
VQTEGSRIATKVLVASTQGSSPPTPAVQATSSGAITLPPKPAPTGTSCEPKIVINTVPQL
HSEKTMYLKSSDNRLLMSLFLFFFVLFLCLFFYNCYKGYLPRQCLKFRSALLIGKKKPKS
DFCDREQSLKETLVEPGSFSQQNGEHPKPALDTGYETEQDTITSKVPTDREDSQRIDDLS
ARDKPFDVKCELKFADSDADGD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O09126	0.919	0.920	0.000	861	0.854	0.855	O09126.pdb.gz	SEM4D_MOUSE Semaphorin-4D OS=Mus musculus OX=10090 GN=Sema4d PE=1 SV=2
2	AFDB:Q92854	1.000	1.000	0.000	862	1.000	1.000	Q92854.pdb.gz	SEM4D_HUMAN Semaphorin-4D OS=Homo sapiens OX=9606 GN=SEMA4D PE=1 SV=1
3	AFDB:Q9NTN9	0.663	0.681	3.304E-72	838	0.316	0.325	Q9NTN9.pdb.gz	SEM4G_HUMAN Semaphorin-4G OS=Homo sapiens OX=9606 GN=SEMA4G PE=1 SV=1
4	AFDB:Q9Z123	0.657	0.725	3.113E-68	777	0.294	0.326	Q9Z123.pdb.gz	SEM4F_MOUSE Semaphorin-4F OS=Mus musculus OX=10090 GN=Sema4f PE=1 SV=2
5	AFDB:Q9W7J1	0.665	0.666	6.383E-65	860	0.287	0.287	Q9W7J1.pdb.gz	SE3AA_DANRE Semaphorin-3aa OS=Danio rerio OX=7955 GN=sema3aa PE=2 SV=1
6	AFDB:A0A2R8Q5P4	0.678	0.770	1.734E-64	756	0.274	0.312	A0A2R8Q5P4.pdb.gz
7	AFDB:M9MM94	0.676	0.749	4.022E-64	775	0.280	0.311	M9MM94.pdb.gz
8	AFDB:Q90663	0.674	0.759	2.534E-63	761	0.260	0.294	Q90663.pdb.gz	SEM3D_CHICK Semaphorin-3D OS=Gallus gallus OX=9031 GN=SEMA3D PE=2 SV=1
9	AFDB:Q13214	0.671	0.768	4.763E-63	749	0.280	0.322	Q13214.pdb.gz	SEM3B_HUMAN Semaphorin-3B OS=Homo sapiens OX=9606 GN=SEMA3B PE=1 SV=1
10	AFDB:Q9W686	0.659	0.727	6.530E-63	778	0.268	0.297	Q9W686.pdb.gz	SE3AB_DANRE Semaphorin-3ab OS=Danio rerio OX=7955 GN=sema3ab PE=2 SV=1
11	PDB:6qp7A	0.602	0.822	4.728E-51	620	0.217	0.302	6qp7A.pdb.gz	Diversity of oligomerization in Drosophila semaphorins suggests a mechanism of functional fine-tuning.
12	PDB:3nvqA	0.581	0.830	8.764E-43	588	0.193	0.282	3nvqA.pdb.gz
13	PDB:3nvnA	0.401	0.862	2.326E-21	383	0.085	0.191	3nvnA.pdb.gz	Structural Basis of Semaphorin-Plexin Recognition and Viral Mimicry from Sema7A and A39R Complexes with PlexinC1.
14	PDB:6vxkB	0.376	0.428	2.767E-15	747	0.109	0.126	6vxkB.pdb.gz
15	PDB:5y31B	0.281	0.439	4.811E-8	511	0.045	0.076	5y31B.pdb.gz	Structural basis of epilepsy-related ligand-receptor complex LGI1-ADAM22.
16	PDB:5juyB	0.173	0.128	1.071E-6	1234	0.066	0.046	5juyB.pdb.gz	A near atomic structure of the active human apoptosome.
17	PDB:7mq8NW	0.252	0.593	2.122E-6	311	0.056	0.154	7mq8NW.pdb.gz	Nucleolar maturation of the human small subunit processome.
18	PDB:7mq8SG	0.249	0.503	2.760E-6	389	0.060	0.134	7mq8SG.pdb.gz	Nucleolar maturation of the human small subunit processome.
19	PDB:1kv9A	0.246	0.306	4.670E-6	664	0.075	0.098	1kv9A.pdb.gz	Structure at 1.9 A resolution of a quinohemoprotein alcohol dehydrogenase from Pseudomonas putida HK5.
20	PDB:3jcmB	0.240	0.437	5.188E-6	429	0.046	0.093	3jcmB.pdb.gz	The 3.8 angstrom structure of the U4/U6.U5 tri-snRNP: Insights into spliceosome assembly and catalysis

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O09126	0.0	1520	861	0.855	0.856	SEM4D_MOUSE Semaphorin-4D OS=Mus musculus OX=10090 GN=Sema4d PE=1 SV=2
2	Q92854	0.0	1795	862	1.000	1.000	SEM4D_HUMAN Semaphorin-4D OS=Homo sapiens OX=9606 GN=SEMA4D PE=1 SV=1
3	Q64151	1.10e-167	509	834	0.323	0.333	SEM4C_MOUSE Semaphorin-4C OS=Mus musculus OX=10090 GN=Sema4c PE=1 SV=1
4	Q9C0C4	6.55e-163	497	833	0.320	0.331	SEM4C_HUMAN Semaphorin-4C OS=Homo sapiens OX=9606 GN=SEMA4C PE=1 SV=2
5	Q62179	2.75e-152	469	823	0.320	0.335	SEM4B_MOUSE Semaphorin-4B OS=Mus musculus OX=10090 GN=Sema4b PE=1 SV=2
6	Q9NTN9	1.59e-138	434	838	0.287	0.295	SEM4G_HUMAN Semaphorin-4G OS=Homo sapiens OX=9606 GN=SEMA4G PE=1 SV=1
7	Q9WUH7	1.47e-135	426	837	0.278	0.287	SEM4G_MOUSE Semaphorin-4G OS=Mus musculus OX=10090 GN=Sema4g PE=1 SV=1
8	Q9Z123	7.54e-129	407	777	0.268	0.297	SEM4F_MOUSE Semaphorin-4F OS=Mus musculus OX=10090 GN=Sema4f PE=1 SV=2
9	Q9Z143	1.43e-126	400	776	0.265	0.294	SEM4F_RAT Semaphorin-4F OS=Rattus norvegicus OX=10116 GN=Sema4f PE=1 SV=1
10	O95754	8.92e-126	398	770	0.268	0.300	SEM4F_HUMAN Semaphorin-4F OS=Homo sapiens OX=9606 GN=SEMA4F PE=2 SV=2
11	Q9H3S1	4.54e-122	388	761	0.284	0.322	SEM4A_HUMAN Semaphorin-4A OS=Homo sapiens OX=9606 GN=SEMA4A PE=1 SV=2
12	Q62178	8.89e-119	380	760	0.281	0.318	SEM4A_MOUSE Semaphorin-4A OS=Mus musculus OX=10090 GN=Sema4a PE=1 SV=2
13	Q63548	1.66e-116	374	772	0.276	0.308	SEM3A_RAT Semaphorin-3A OS=Rattus norvegicus OX=10116 GN=Sema3a PE=2 SV=1
14	O08665	2.18e-116	374	772	0.276	0.308	SEM3A_MOUSE Semaphorin-3A OS=Mus musculus OX=10090 GN=Sema3a PE=1 SV=2
15	Q9W686	2.26e-116	374	778	0.269	0.298	SE3AB_DANRE Semaphorin-3ab OS=Danio rerio OX=7955 GN=sema3ab PE=2 SV=1
16	Q14563	6.01e-114	367	771	0.269	0.301	SEM3A_HUMAN Semaphorin-3A OS=Homo sapiens OX=9606 GN=SEMA3A PE=1 SV=1
17	Q90607	2.15e-113	366	772	0.288	0.321	SEM3A_CHICK Semaphorin-3A OS=Gallus gallus OX=9031 GN=SEMA3A PE=1 SV=1
18	F1NVZ5	1.15e-112	365	808	0.288	0.307	F1NVZ5_CHICK Semaphorin 3A OS=Gallus gallus OX=9031 GN=SEMA3A PE=3 SV=2
19	Q99985	9.98e-110	355	751	0.262	0.301	SEM3C_HUMAN Semaphorin-3C OS=Homo sapiens OX=9606 GN=SEMA3C PE=2 SV=2
20	Q62181	2.40e-108	352	751	0.255	0.293	SEM3C_MOUSE Semaphorin-3C OS=Mus musculus OX=10090 GN=Sema3c PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13030 DUF3891	1.5e+02	13.5	Protein of unknown function (DUF3891)
2	PF07679 I-set	3.4e+02	12.7	Immunoglobulin I-set domain
3	PF00047 ig	0.00019	32.9	Immunoglobulin domain
4	PF13895 Ig_2	26	16.5	Immunoglobulin domain
5	PF13927 Ig_3	0.5	22.3	Immunoglobulin domain
6	PF16681 Ig_5	9.6	18.0	Ig-like domain on T-cell surface glycoprotein CD3 epsilon chain
7	PF01437 PSI	0.00096	31.0	Plexin repeat
8	PF01403 Sema	4e-57	204.5	Sema domain
9	PF07686 V-set	1.2e+02	14.3	Immunoglobulin V-set domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000416523

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000351338	0.999	Plexin-B1
2	9606.ENSP00000379980	0.998	B-cell differentiation antigen CD72
3	9606.ENSP00000411355	0.997	Receptor-type tyrosine-protein phosphatase C
4	9606.ENSP00000409171	0.996	Plexin-B2
5	9606.ENSP00000246792	0.971	Ras-related protein R-Ras
6	9606.ENSP00000442736	0.963	Plexin-B3
7	9606.ENSP00000400175	0.954	Transforming protein RhoA
8	9606.ENSP00000258526	0.943	Plexin-C1
9	9606.ENSP00000285735	0.927	Rho-related GTP-binding protein RhoC
10	9606.ENSP00000317128	0.925	Plexin-D1
11	9606.ENSP00000272233	0.921	Rho-related GTP-binding protein RhoB
12	9606.ENSP00000377061	0.907	Plexin-A1
13	9606.ENSP00000352882	0.886	Plexin-A4
14	9606.ENSP00000358696	0.886	Plexin-A3
15	9606.ENSP00000356000	0.885	Plexin-A2
16	9606.ENSP00000308461	0.878	Rho-related GTP-binding protein Rho6
17	9606.ENSP00000317272	0.858	Hepatocyte growth factor receptor
18	9606.ENSP00000380942	0.850	Rho guanine nucleotide exchange factor 12
19	9606.ENSP00000357177	0.800	Rho guanine nucleotide exchange factor 11
20	9606.ENSP00000265371	0.771	Neuropilin-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0030215	1.000	semaphorin receptor binding
GO:0004888	0.977	transmembrane signaling receptor activity
GO:0042802	0.798	identical protein binding
GO:0038191	0.327	neuropilin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0048518	0.988	positive regulation of biological process
GO:0007165	0.986	signal transduction
GO:0032501	0.983	multicellular organismal process
GO:0048856	0.977	anatomical structure development
GO:0048522	0.977	positive regulation of cellular process
GO:0050793	0.975	regulation of developmental process
GO:0051128	0.966	regulation of cellular component organization
GO:0051239	0.961	regulation of multicellular organismal process
GO:0060255	0.961	regulation of macromolecule metabolic process
GO:0007275	0.961	multicellular organism development
GO:0080090	0.960	regulation of primary metabolic process
GO:0051171	0.960	regulation of nitrogen compound metabolic process
GO:0065009	0.959	regulation of molecular function
GO:0051174	0.959	regulation of phosphorus metabolic process
GO:0050790	0.953	regulation of catalytic activity
GO:0007166	0.951	cell surface receptor signaling pathway
GO:0048519	0.950	negative regulation of biological process
GO:0051094	0.948	positive regulation of developmental process
GO:0022603	0.941	regulation of anatomical structure morphogenesis
GO:0048523	0.933	negative regulation of cellular process
GO:2000026	0.931	regulation of multicellular organismal development
GO:0031344	0.926	regulation of cell projection organization
GO:0040012	0.924	regulation of locomotion
GO:0051336	0.924	regulation of hydrolase activity
GO:0019220	0.921	regulation of phosphate metabolic process
GO:0071526	0.917	semaphorin-plexin signaling pathway
GO:0060284	0.916	regulation of cell development
GO:0051130	0.912	positive regulation of cellular component organization
GO:0120035	0.908	regulation of plasma membrane bounded cell projection organization
GO:0010562	0.907	positive regulation of phosphorus metabolic process
GO:0048583	0.904	regulation of response to stimulus
GO:0045937	0.903	positive regulation of phosphate metabolic process
GO:0051962	0.902	positive regulation of nervous system development
GO:0016043	0.895	cellular component organization
GO:0009653	0.892	anatomical structure morphogenesis
GO:0042325	0.892	regulation of phosphorylation
GO:0031399	0.885	regulation of protein modification process
GO:0001932	0.880	regulation of protein phosphorylation
GO:0045597	0.876	positive regulation of cell differentiation
GO:0042327	0.867	positive regulation of phosphorylation
GO:0048731	0.864	system development
GO:0030335	0.860	positive regulation of cell migration
GO:0001934	0.860	positive regulation of protein phosphorylation
GO:0051345	0.857	positive regulation of hydrolase activity
GO:0050767	0.856	regulation of neurogenesis
GO:0030154	0.851	cell differentiation
GO:0050769	0.830	positive regulation of neurogenesis
GO:0065008	0.826	regulation of biological quality
GO:0009892	0.803	negative regulation of metabolic process
GO:0048468	0.783	cell development
GO:0031346	0.768	positive regulation of cell projection organization
GO:0007399	0.762	nervous system development
GO:0010468	0.706	regulation of gene expression
GO:0050770	0.699	regulation of axonogenesis
GO:0044087	0.696	regulation of cellular component biogenesis
GO:0010605	0.687	negative regulation of macromolecule metabolic process
GO:2001141	0.667	regulation of RNA biosynthetic process
GO:0043086	0.653	negative regulation of catalytic activity
GO:0048513	0.649	animal organ development
GO:0043087	0.646	regulation of GTPase activity
GO:0051172	0.637	negative regulation of nitrogen compound metabolic process
GO:0045936	0.623	negative regulation of phosphate metabolic process
GO:0050772	0.623	positive regulation of axonogenesis
GO:0023051	0.619	regulation of signaling
GO:0010646	0.619	regulation of cell communication
GO:0051346	0.603	negative regulation of hydrolase activity
GO:1902531	0.595	regulation of intracellular signal transduction
GO:1903506	0.525	regulation of nucleic acid-templated transcription
GO:0048584	0.519	positive regulation of response to stimulus
GO:0060348	0.519	bone development
GO:0001503	0.509	ossification
GO:0040008	0.508	regulation of growth
GO:0030155	0.456	regulation of cell adhesion
GO:0007155	0.447	cell adhesion
GO:0051093	0.447	negative regulation of developmental process
GO:0022008	0.425	neurogenesis
GO:0023056	0.421	positive regulation of signaling
GO:0010647	0.421	positive regulation of cell communication
GO:0009967	0.399	positive regulation of signal transduction
GO:1902533	0.387	positive regulation of intracellular signal transduction
GO:0006355	0.370	regulation of DNA-templated transcription
GO:0030182	0.365	neuron differentiation
GO:0048666	0.336	neuron development
GO:0031175	0.303	neuron projection development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	1.000	membrane
GO:0005886	0.991	plasma membrane
GO:0005576	0.977	extracellular region
GO:0005615	0.867	extracellular space
GO:0043226	0.329	organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]