StarFunc result for job id Q92858

User Input

>input (354 residues)
MSRLLHAEEWAEVKELGDHHRQPQPHHLPQPPPPPQPPATLQAREHPVYPPELSLLDSTD
PRAWLAPTLQGICTARAAQYLLHSPELGASEAAAPRDEVDGRGELVRRSSGGASSSKSPG
PVKVREQLCKLKGGVVVDELGCSRQRAPSSKQVNGVQKQRRLAANARERRRMHGLNHAFD
QLRNVIPSFNNDKKLSKYETLQMAQIYINALSELLQTPSGGEQPPPPPASCKSDHHHLRT
AASYEGGAGNATAAGAQQASGGSQRPTPPGSCRTRFSAPASAGGYSVQLDALHFSTFEDS
ALTAMMAQKNLSPSLPGSILQPVQEENSKTSPRSHRSDGEFSPHSHYSDSDEAS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q92858	0.999	0.999	4.505E-51	354	1.000	1.000	Q92858.pdb.gz	ATOH1_HUMAN Transcription factor ATOH1 OS=Homo sapiens OX=9606 GN=ATOH1 PE=2 SV=1
2	AFDB:P48985	0.568	0.572	2.747E-43	351	0.884	0.892	P48985.pdb.gz	ATOH1_MOUSE Transcription factor Atoh1 OS=Mus musculus OX=10090 GN=Atoh1 PE=1 SV=1
3	AFDB:B0R059	0.266	0.316	1.547E-16	292	0.458	0.555	B0R059.pdb.gz	B0R059_DANRE Atonal bHLH transcription factor 1a OS=Danio rerio OX=7955 GN=Atoh1.1 PE=4 SV=1
4	AFDB:O42606	0.213	0.356	5.688E-6	208	0.178	0.303	O42606.pdb.gz	NGN1_DANRE Neurogenin-1 OS=Danio rerio OX=7955 GN=neurog1 PE=2 SV=1
5	AFDB:Q9Y4Z2	0.207	0.333	4.595E-5	214	0.167	0.276	Q9Y4Z2.pdb.gz	NGN3_HUMAN Neurogenin-3 OS=Homo sapiens OX=9606 GN=NEUROG3 PE=1 SV=2
6	AFDB:O08718	0.203	0.329	1.263E-4	214	0.172	0.285	O08718.pdb.gz	O08718_RAT Neurogenin 3 OS=Rattus norvegicus OX=10116 GN=Neurog3 PE=4 SV=1
7	AFDB:Q9H2A3	0.207	0.267	2.835E-4	272	0.198	0.257	Q9H2A3.pdb.gz	NGN2_HUMAN Neurogenin-2 OS=Homo sapiens OX=9606 GN=NEUROG2 PE=1 SV=2
8	AFDB:P70447	0.196	0.262	3.712E-4	263	0.218	0.293	P70447.pdb.gz	NGN2_MOUSE Neurogenin-2 OS=Mus musculus OX=10090 GN=Neurog2 PE=1 SV=1
9	AFDB:Q7RTS3	0.173	0.186	4.247E-4	328	0.220	0.238	Q7RTS3.pdb.gz	PTF1A_HUMAN Pancreas transcription factor 1 subunit alpha OS=Homo sapiens OX=9606 GN=PTF1A PE=1 SV=1
10	AFDB:P12980	0.256	0.310	6.364E-4	280	0.189	0.239	P12980.pdb.gz	LYL1_HUMAN Protein lyl-1 OS=Homo sapiens OX=9606 GN=LYL1 PE=1 SV=3
11	PDB:4v8sAY	0.101	0.096	1.722	376	0.031	0.029	4v8sAY.pdb.gz	Structural and Functional Analyses of the Interaction of Archaeal RNA Polymerase with DNA.
12	PDB:3ojaA	0.148	0.112	1.842	482	0.037	0.027	3ojaA.pdb.gz	A heterodimeric complex of the LRR proteins LRIM1 and APL1C regulates complement-like immunity in Anopheles gambiae.
13	PDB:4jjnA	0.090	0.271	3.614	98	0.037	0.133	4jjnA.pdb.gz	Heterochromatin protein Sir3 induces contacts between the amino terminus of histone H4 and nucleosomal DNA.
14	PDB:6lo8H	0.106	0.379	3.866	74	0.025	0.122	6lo8H.pdb.gz
15	PDB:6bk8K	0.077	0.276	4.732	82	0.037	0.159	6bk8K.pdb.gz	Structure of the yeast spliceosomal postcatalytic P complex.
16	PDB:6lo8E	0.087	0.257	4.732	80	0.025	0.113	6lo8E.pdb.gz
17	PDB:7suk5	0.100	0.112	5.062	296	0.045	0.054	7suk5.pdb.gz	Artificial intelligence-assisted cryoEM structure of Bfr2-Lcp5 complex observed in the yeast small subunit processome.
18	PDB:7acjy	0.084	0.293	5.415	86	0.028	0.116	7acjy.pdb.gz	Structures of tmRNA and SmpB as they transit through the ribosome.
19	PDB:7ey9a	0.075	0.155	6.196	141	0.037	0.092	7ey9a.pdb.gz
20	PDB:1kx5B	0.068	0.223	6.628	102	0.040	0.137	1kx5B.pdb.gz	Solvent Mediated Interactions in the Structure of the Nucleosome Core Particle at 1.9 A Resolution

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P48985	0.0	591	351	0.884	0.892	ATOH1_MOUSE Transcription factor Atoh1 OS=Mus musculus OX=10090 GN=Atoh1 PE=1 SV=1
2	Q92858	0.0	719	354	1.000	1.000	ATOH1_HUMAN Transcription factor ATOH1 OS=Homo sapiens OX=9606 GN=ATOH1 PE=2 SV=1
3	B0R059	5.39e-76	238	292	0.449	0.545	B0R059_DANRE Atonal bHLH transcription factor 1a OS=Danio rerio OX=7955 GN=Atoh1.1 PE=4 SV=1
4	B3DH94	9.19e-28	110	206	0.150	0.257	B3DH94_DANRE Atonal bHLH transcription factor 1b OS=Danio rerio OX=7955 GN=Atoh1.2 PE=2 SV=1
5	O57598	1.97e-21	91.3	151	0.138	0.325	ATOH7_CHICK Transcription factor ATOH7 OS=Gallus gallus OX=9031 GN=ATOH7 PE=1 SV=2
6	Q9Y0A7	1.07e-19	87.8	198	0.119	0.212	AMOS_DROME Basic helix-loop-helix transcription factor amos OS=Drosophila melanogaster OX=7227 GN=amos PE=1 SV=2
7	O13125	1.12e-19	86.3	138	0.116	0.297	ATO7A_XENLA Transcription factor Atoh7-a OS=Xenopus laevis OX=8355 GN=atoh7-a PE=1 SV=1
8	Q10574	2.39e-19	85.5	142	0.127	0.317	LIN32_CAEEL Protein lin-32 OS=Caenorhabditis elegans OX=6239 GN=lin-32 PE=1 SV=2
9	P48987	3.23e-19	89.0	312	0.113	0.128	ATO_DROME Protein atonal OS=Drosophila melanogaster OX=7227 GN=ato PE=1 SV=2
10	Q8AW52	6.38e-19	84.0	134	0.110	0.291	ATOH7_DANRE Transcription factor atoh7 OS=Danio rerio OX=7955 GN=atoh7 PE=1 SV=1
11	Q9XZC7	7.12e-19	85.5	189	0.116	0.217	Q9XZC7_DROME CATO OS=Drosophila melanogaster OX=7227 GN=cato PE=4 SV=1
12	Q0IGT4	7.95e-19	85.5	189	0.116	0.217	Q0IGT4_DROME Cousin of atonal OS=Drosophila melanogaster OX=7227 GN=cato PE=2 SV=1
13	Q6NYU3	5.06e-18	85.9	327	0.124	0.135	NDF6A_DANRE Neurogenic differentiation factor 6-A OS=Danio rerio OX=7955 GN=neurod6a PE=2 SV=1
14	O42606	6.26e-17	80.5	208	0.113	0.192	NGN1_DANRE Neurogenin-1 OS=Danio rerio OX=7955 GN=neurog1 PE=2 SV=1
15	Q9H2A3	1.58e-15	77.8	272	0.105	0.136	NGN2_HUMAN Neurogenin-2 OS=Homo sapiens OX=9606 GN=NEUROG2 PE=1 SV=2
16	P70447	1.71e-15	77.8	263	0.105	0.141	NGN2_MOUSE Neurogenin-2 OS=Mus musculus OX=10090 GN=Neurog2 PE=1 SV=1
17	P79765	2.25e-15	78.6	357	0.102	0.101	NDF1_CHICK Neurogenic differentiation factor 1 OS=Gallus gallus OX=9031 GN=NEUROD1 PE=2 SV=1
18	Q64289	2.84e-15	78.2	357	0.102	0.101	NDF1_RAT Neurogenic differentiation factor 1 OS=Rattus norvegicus OX=10116 GN=Neurod1 PE=1 SV=1
19	Q60867	2.92e-15	78.2	357	0.102	0.101	NDF1_MOUSE Neurogenic differentiation factor 1 OS=Mus musculus OX=10090 GN=Neurod1 PE=1 SV=2
20	Q13562	3.10e-15	78.2	356	0.102	0.101	NDF1_HUMAN Neurogenic differentiation factor 1 OS=Homo sapiens OX=9606 GN=NEUROD1 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00010 HLH	5e-14	63.3	Helix-loop-helix DNA-binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000302216

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000388940	0.940	Transcription factor 12
2	9606.ENSP00000381382	0.930	Transcription factor 4
3	9606.ENSP00000262965	0.891	Transcription factor E2-alpha
4	9606.ENSP00000266744	0.837	Achaete-scute homolog 1
5	9606.ENSP00000230732	0.834	POU domain, class 4, transcription factor 3
6	9606.ENSP00000323588	0.802	Transcription factor SOX-2
7	9606.ENSP00000386331	0.800	Unconventional myosin-VIIa
8	9606.ENSP00000359357	0.779	Zinc finger protein Gfi-1
9	9606.ENSP00000366413	0.772	POU domain, class 4, transcription factor 1
10	9606.ENSP00000232424	0.765	Transcription factor HES-1
11	9606.ENSP00000277541	0.748	Neurogenic locus notch homolog protein 1
12	9606.ENSP00000406861	0.736	Mucin-6
13	9606.ENSP00000297261	0.731	Sonic hedgehog protein
14	9606.ENSP00000404100	0.729	Paired box protein Pax-6
15	9606.ENSP00000263610	0.711	BarH-like 1 homeobox protein
16	9606.ENSP00000355718	0.703	Delta-like protein 1
17	9606.ENSP00000359319	0.681	Paired box protein Pax-2
18	9606.ENSP00000254958	0.677	Protein jagged-1
19	9606.ENSP00000342626	0.677	Eyes absent homolog 1
20	9606.ENSP00000367059	0.672	Espin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003700	1.000	DNA-binding transcription factor activity
GO:1990837	1.000	sequence-specific double-stranded DNA binding
GO:0005515	0.997	protein binding
GO:0000976	0.943	transcription cis-regulatory region binding
GO:0000981	0.719	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000977	0.686	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000987	0.469	cis-regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0048856	0.994	anatomical structure development
GO:0032501	0.990	multicellular organismal process
GO:0007275	0.969	multicellular organism development
GO:0048731	0.919	system development
GO:0050789	0.918	regulation of biological process
GO:0050794	0.912	regulation of cellular process
GO:0007399	0.881	nervous system development
GO:0071704	0.831	organic substance metabolic process
GO:0044237	0.817	cellular metabolic process
GO:0019222	0.798	regulation of metabolic process
GO:0060255	0.793	regulation of macromolecule metabolic process
GO:0006807	0.776	nitrogen compound metabolic process
GO:0043170	0.762	macromolecule metabolic process
GO:0044238	0.760	primary metabolic process
GO:0080090	0.696	regulation of primary metabolic process
GO:0051171	0.696	regulation of nitrogen compound metabolic process
GO:0031323	0.691	regulation of cellular metabolic process
GO:0010468	0.688	regulation of gene expression
GO:0019438	0.687	aromatic compound biosynthetic process
GO:0048518	0.659	positive regulation of biological process
GO:0019219	0.638	regulation of nucleobase-containing compound metabolic process
GO:0048522	0.635	positive regulation of cellular process
GO:0010556	0.628	regulation of macromolecule biosynthetic process
GO:0031326	0.628	regulation of cellular biosynthetic process
GO:0051252	0.625	regulation of RNA metabolic process
GO:0048513	0.623	animal organ development
GO:0006355	0.606	regulation of DNA-templated transcription
GO:0046483	0.585	heterocycle metabolic process
GO:0034641	0.574	cellular nitrogen compound metabolic process
GO:1901360	0.524	organic cyclic compound metabolic process
GO:0050896	0.513	response to stimulus
GO:0010467	0.492	gene expression
GO:1901362	0.491	organic cyclic compound biosynthetic process
GO:0006139	0.480	nucleobase-containing compound metabolic process
GO:0018130	0.468	heterocycle biosynthetic process
GO:0010604	0.468	positive regulation of macromolecule metabolic process
GO:0044271	0.459	cellular nitrogen compound biosynthetic process
GO:0030154	0.458	cell differentiation
GO:0090304	0.431	nucleic acid metabolic process
GO:0048519	0.415	negative regulation of biological process
GO:0006357	0.412	regulation of transcription by RNA polymerase II
GO:0034654	0.392	nucleobase-containing compound biosynthetic process
GO:0051173	0.371	positive regulation of nitrogen compound metabolic process
GO:0007417	0.362	central nervous system development
GO:0031325	0.362	positive regulation of cellular metabolic process
GO:0045935	0.352	positive regulation of nucleobase-containing compound metabolic process
GO:0031328	0.340	positive regulation of cellular biosynthetic process
GO:0010557	0.339	positive regulation of macromolecule biosynthetic process
GO:0051254	0.339	positive regulation of RNA metabolic process
GO:0048523	0.330	negative regulation of cellular process
GO:1903508	0.325	positive regulation of nucleic acid-templated transcription
GO:0045893	0.324	positive regulation of DNA-templated transcription
GO:0006351	0.305	DNA-templated transcription

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0070013	0.963	intracellular organelle lumen
GO:0005654	0.932	nucleoplasm
GO:0005737	0.671	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]