StarFunc result for job id Q92859

User Input

>input (1461 residues)
MAAERGARRLLSTPSFWLYCLLLLGRRAPGAAAARSGSAPQSPGASIRTFTPFYFLVEPV
DTLSVRGSSVILNCSAYSEPSPKIEWKKDGTFLNLVSDDRRQLLPDGSLFISNVVHSKHN
KPDEGYYQCVATVESLGTIISRTAKLIVAGLPRFTSQPEPSSVYAGNNAILNCEVNADLV
PFVRWEQNRQPLLLDDRVIKLPSGMLVISNATEGDGGLYRCVVESGGPPKYSDEVELKVL
PDPEVISDLVFLKQPSPLVRVIGQDVVLPCVASGLPTPTIKWMKNEEALDTESSERLVLL
AGGSLEISDVTEDDAGTYFCIADNGNETIEAQAELTVQAQPEFLKQPTNIYAHESMDIVF
ECEVTGKPTPTVKWVKNGDMVIPSDYFKIVKEHNLQVLGLVKSDEGFYQCIAENDVGNAQ
AGAQLIILEHAPATTGPLPSAPRDVVASLVSTRFIKLTWRTPASDPHGDNLTYSVFYTKE
GIARERVENTSHPGEMQVTIQNLMPATVYIFRVMAQNKHGSGESSAPLRVETQPEVQLPG
PAPNLRAYAASPTSITVTWETPVSGNGEIQNYKLYYMEKGTDKEQDVDVSSHSYTINGLK
KYTEYSFRVVAYNKHGPGVSTPDVAVRTLSDVPSAAPQNLSLEVRNSKSIMIHWQPPAPA
TQNGQITGYKIRYRKASRKSDVTETLVSGTQLSQLIEGLDRGTEYNFRVAALTINGTGPA
TDWLSAETFESDLDETRVPEVPSSLHVRPLVTSIVVSWTPPENQNIVVRGYAIGYGIGSP
HAQTIKVDYKQRYYTIENLDPSSHYVITLKAFNNVGEGIPLYESAVTRPHTDTSEVDLFV
INAPYTPVPDPTPMMPPVGVQASILSHDTIRITWADNSLPKHQKITDSRYYTVRWKTNIP
ANTKYKNANATTLSYLVTGLKPNTLYEFSVMVTKGRRSSTWSMTAHGTTFELVPTSPPKD
VTVVSKEGKPKTIIVNWQPPSEANGKITGYIIYYSTDVNAEIHDWVIEPVVGNRLTHQIQ
ELTLDTPYYFKIQARNSKGMGPMSEAVQFRTPKADSSDKMPNDQASGSGGKGSRLPDLGS
DYKPPMSGSNSPHGSPTSPLDSNMLLVIIVSVGVITIVVVVIIAVFCTRRTTSHQKKKRA
ACKSVNGSHKYKGNSKDVKPPDLWIHHERLELKPIDKSPDPNPIMTDTPIPRNSQDITPV
DNSMDSNIHQRRNSYRGHESEDSMSTLAGRRGMRPKMMMPFDSQPPQPVISAHPIHSLDN
PHHHFHSSSLASPARSHLYHPGSPWPIGTSMSLSDRANSTESVRNTPSTDTMPASSSQTC
CTDHQDPEGATSSSYLASSQEEDSGQSLPTAHVRPSHPLKSFAVPAIPPPGPPTYDPALP
STPLLSQQALNHHIHSVKTASIGTLGRSRPPMPVVVPSAPEVQETTRMLEDSESSYEPDE
LTKEMAHLEGLMKDLNAITTA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0R4IP15	0.200	0.204	0.000	1428	0.681	0.697	A0A0R4IP15.pdb.gz	A0A0R4IP15_DANRE Neogenin 1a OS=Danio rerio OX=7955 GN=cb333 PE=1 SV=1
2	AFDB:P43146	0.343	0.346	0.000	1447	0.507	0.512	P43146.pdb.gz	DCC_HUMAN Netrin receptor DCC OS=Homo sapiens OX=9606 GN=DCC PE=1 SV=2
3	AFDB:P97603	0.564	0.594	0.000	1377	0.888	0.943	P97603.pdb.gz	NEO1_RAT Neogenin (Fragment) OS=Rattus norvegicus OX=10116 GN=Neo1 PE=1 SV=1
4	AFDB:P97798	0.275	0.270	0.000	1493	0.930	0.910	P97798.pdb.gz	NEO1_MOUSE Neogenin OS=Mus musculus OX=10090 GN=Neo1 PE=1 SV=2
5	AFDB:Q92859	1.000	1.000	0.000	1461	1.000	1.000	Q92859.pdb.gz	NEO1_HUMAN Neogenin OS=Homo sapiens OX=9606 GN=NEO1 PE=1 SV=2
6	AFDB:F1R2D2	0.130	0.114	4.898E-63	1687	0.216	0.187	F1R2D2.pdb.gz
7	AFDB:O55005	0.130	0.116	6.556E-62	1651	0.205	0.181	O55005.pdb.gz	ROBO1_RAT Roundabout homolog 1 OS=Rattus norvegicus OX=10116 GN=Robo1 PE=1 SV=1
8	AFDB:A0A0G2JZA1	0.127	0.123	1.282E-61	1512	0.208	0.201	A0A0G2JZA1.pdb.gz	A0A0G2JZA1_RAT Roundabout guidance receptor 2 OS=Rattus norvegicus OX=10116 GN=Robo2 PE=4 SV=2
9	AFDB:R9QT79	0.121	0.145	1.099E-27	1132	0.106	0.137	R9QT79.pdb.gz	R9QT79_ONCMY Long-form leptin receptor OS=Oncorhynchus mykiss OX=8022 GN=LepR PE=2 SV=1
10	AFDB:Q6WRH9	0.105	0.065	4.301E-26	2597	0.107	0.060	Q6WRH9.pdb.gz	IGS10_RAT Immunoglobulin superfamily member 10 OS=Rattus norvegicus OX=10116 GN=Igsf10 PE=1 SV=1
11	PDB:5oj2B	0.098	0.186	3.575E-24	692	0.084	0.176	5oj2B.pdb.gz
12	PDB:1e07A	0.101	0.188	3.355E-19	642	0.079	0.179	1e07A.pdb.gz
13	PDB:5a42A	0.103	0.098	7.692E-16	1597	0.078	0.071	5a42A.pdb.gz
14	PDB:7q1yA	0.083	0.086	1.346E-14	1374	0.061	0.065	7q1yA.pdb.gz
15	PDB:7q5zA	0.074	0.077	1.540E-14	1344	0.060	0.065	7q5zA.pdb.gz
16	PDB:7sqcO0	0.109	0.132	2.013E-14	1140	0.066	0.084	7sqcO0.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
17	PDB:8dtlA	0.113	0.209	3.938E-14	741	0.044	0.086	8dtlA.pdb.gz
18	PDB:8eyyA	0.111	0.198	7.366E-14	775	0.048	0.090	8eyyA.pdb.gz
19	PDB:6pxvA	0.114	0.191	8.424E-14	823	0.042	0.075	6pxvA.pdb.gz
20	PDB:6pyhD	0.109	0.187	1.205E-13	798	0.045	0.083	6pyhD.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0R4IIB3	0.0	2043	1409	0.691	0.716	A0A0R4IIB3_DANRE Neogenin 1a OS=Danio rerio OX=7955 GN=cb333 PE=3 SV=2
2	A0A0R4IP15	0.0	2065	1428	0.697	0.713	A0A0R4IP15_DANRE Neogenin 1a OS=Danio rerio OX=7955 GN=cb333 PE=1 SV=1
3	A1Z921	0.0	739	1375	0.341	0.362	A1Z921_DROME Frazzled, isoform B OS=Drosophila melanogaster OX=7227 GN=fra PE=1 SV=1
4	P43146	0.0	1385	1447	0.509	0.514	DCC_HUMAN Netrin receptor DCC OS=Homo sapiens OX=9606 GN=DCC PE=1 SV=2
5	P70211	0.0	1384	1447	0.507	0.512	DCC_MOUSE Netrin receptor DCC OS=Mus musculus OX=10090 GN=Dcc PE=1 SV=2
6	P97603	0.0	2613	1377	0.889	0.943	NEO1_RAT Neogenin (Fragment) OS=Rattus norvegicus OX=10116 GN=Neo1 PE=1 SV=1
7	P97798	0.0	2771	1492	0.943	0.923	NEO1_MOUSE Neogenin OS=Mus musculus OX=10090 GN=Neo1 PE=1 SV=2
8	Q3S3D7	0.0	2022	1441	0.695	0.704	Q3S3D7_XENBO Neogenin variant 1 OS=Xenopus borealis OX=8354 PE=2 SV=1
9	Q49BB0	0.0	1329	1421	0.480	0.493	Q49BB0_DANRE Deleted in colorectal cancer OS=Danio rerio OX=7955 GN=zdcc PE=1 SV=1
10	Q59FP8	0.0	2258	1130	0.760	0.982	Q59FP8_HUMAN Neogenin 1 (Fragment) OS=Homo sapiens OX=9606 GN=NEO1 PE=1 SV=1
11	Q63155	0.0	1383	1445	0.505	0.511	DCC_RAT Netrin receptor DCC OS=Rattus norvegicus OX=10116 GN=Dcc PE=1 SV=2
12	Q91562	0.0	1395	1427	0.501	0.513	Q91562_XENLA Deleted in colorectal carcinoma OS=Xenopus laevis OX=8355 GN=dcc.L PE=1 SV=1
13	Q92859	0.0	3014	1461	1.000	1.000	NEO1_HUMAN Neogenin OS=Homo sapiens OX=9606 GN=NEO1 PE=1 SV=2
14	Q94537	0.0	741	1375	0.342	0.363	Q94537_DROME Frazzled OS=Drosophila melanogaster OX=7227 GN=fra PE=2 SV=1
15	G5EF96	7.79e-170	549	1415	0.239	0.247	UNC40_CAEEL Netrin receptor unc-40 OS=Caenorhabditis elegans OX=6239 GN=unc-40 PE=1 SV=1
16	Q94538	3.59e-160	526	1526	0.244	0.234	Q94538_DROME Frazzled OS=Drosophila melanogaster OX=7227 GN=fra PE=1 SV=1
17	A1Z920	5.29e-160	525	1526	0.244	0.234	A1Z920_DROME FI24025p1 OS=Drosophila melanogaster OX=7227 GN=fra PE=1 SV=1
18	A0A0B4LEX6	5.38e-160	525	1517	0.244	0.235	A0A0B4LEX6_DROME Frazzled, isoform C OS=Drosophila melanogaster OX=7227 GN=fra PE=1 SV=1
19	Q2EY14	8.56e-79	286	1149	0.172	0.219	PRTGA_DANRE Protogenin A OS=Danio rerio OX=7955 GN=prtga PE=2 SV=1
20	Q2VWP7	8.84e-75	275	1150	0.162	0.205	PRTG_HUMAN Protogenin OS=Homo sapiens OX=9606 GN=PRTG PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08205 C2-set_2	4.8e-07	41.1	CD80-like C2-set immunoglobulin domain
2	PF16323 DUF4959	0.3	22.8	Domain of unknown function (DUF4959)
3	PF14575 EphA2_TM	48	16.1	Ephrin type-A receptor 2 transmembrane domain
4	PF00754 F5_F8_type_C	3.1e+02	12.9	F5/8 type C domain
5	PF00041 fn3	6.7e-81	278.1	Fibronectin type III domain
6	PF16893 fn3_2	0.0014	30.0	Fibronectin type III domain
7	PF16794 fn3_4	0.0015	29.8	Fibronectin-III type domain
8	PF07982 Herpes_UL74	2.2e+02	12.2	Herpes UL74 glycoproteins
9	PF07679 I-set	1.3e-55	196.7	Immunoglobulin I-set domain
10	PF00047 ig	2.2e-30	116.0	Immunoglobulin domain
11	PF13895 Ig_2	4.2e-38	140.8	Immunoglobulin domain
12	PF13927 Ig_3	8.6e-48	172.1	Immunoglobulin domain
13	PF16680 Ig_4	0.015	27.2	T-cell surface glycoprotein CD3 delta chain
14	PF16681 Ig_5	6.3e-08	44.3	Ig-like domain on T-cell surface glycoprotein CD3 epsilon chain
15	PF09294 Interfer-bind	1.7e-10	52.5	Interferon-alpha/beta receptor, fibronectin type III
16	PF16706 Izumo-Ig	30	16.0	Izumo-like Immunoglobulin domain
17	PF08391 Ly49	4.3e+02	12.7	Ly49-like protein, N-terminal region
18	PF10179 NDNF	2.3e-05	35.9	Neuron-derived neurotrophic factor, first Fn(III) domain
19	PF06583 Neogenin_C	3.6e-110	380.1	Neogenin C-terminus
20	PF16656 Pur_ac_phosph_N	4.2e-21	86.7	Purple acid Phosphatase, N-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000341198

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000173229	0.999	Netrin-1
2	9606.ENSP00000308219	0.999	RGM domain family member B
3	9606.ENSP00000337014	0.999	Hemojuvelin
4	9606.ENSP00000452126	0.999	Repulsive guidance molecule A
5	9606.ENSP00000334329	0.991	Netrin receptor UNC5B
6	9606.ENSP00000340998	0.977	Netrin-4
7	9606.ENSP00000293973	0.966	Netrin-3
8	9606.ENSP00000341189	0.937	Focal adhesion kinase 1
9	9606.ENSP00000368104	0.927	Bone morphogenetic protein 2
10	9606.ENSP00000361107	0.916	Bone morphogenetic protein receptor type-1A
11	9606.ENSP00000294485	0.904	Draxin
12	9606.ENSP00000380942	0.895	Rho guanine nucleotide exchange factor 12
13	9606.ENSP00000263640	0.873	Activin receptor type-1
14	9606.ENSP00000401907	0.873	Bone morphogenetic protein receptor type-1B
15	9606.ENSP00000421280	0.873	Unconventional myosin-X
16	9606.ENSP00000332737	0.872	Netrin receptor UNC5A
17	9606.ENSP00000406022	0.834	Netrin receptor UNC5C
18	9606.ENSP00000371211	0.823	Transmembrane protease serine 6
19	9606.ENSP00000385143	0.814	Netrin receptor UNC5D
20	9606.ENSP00000181796	0.764	Protein FAM107B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0039706	0.758	co-receptor binding
GO:0038023	0.617	signaling receptor activity
GO:0004888	0.359	transmembrane signaling receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.985	cellular process
GO:0050794	0.977	regulation of cellular process
GO:0032502	0.855	developmental process
GO:0048856	0.838	anatomical structure development
GO:0032501	0.749	multicellular organismal process
GO:0050896	0.696	response to stimulus
GO:0007275	0.660	multicellular organism development
GO:0048731	0.607	system development
GO:0071840	0.544	cellular component organization or biogenesis
GO:0009653	0.544	anatomical structure morphogenesis
GO:0048519	0.530	negative regulation of biological process
GO:0048523	0.493	negative regulation of cellular process
GO:0048518	0.473	positive regulation of biological process
GO:0016043	0.460	cellular component organization
GO:0007399	0.440	nervous system development
GO:0048522	0.423	positive regulation of cellular process
GO:0023051	0.395	regulation of signaling
GO:0010646	0.393	regulation of cell communication
GO:0048583	0.376	regulation of response to stimulus
GO:0048869	0.307	cellular developmental process
GO:0050793	0.300	regulation of developmental process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0005622	0.973	intracellular anatomical structure
GO:0005737	0.957	cytoplasm
GO:0043226	0.947	organelle
GO:0005829	0.868	cytosol
GO:0043231	0.853	intracellular membrane-bounded organelle
GO:0012505	0.832	endomembrane system
GO:0120025	0.625	plasma membrane bounded cell projection
GO:0031974	0.549	membrane-enclosed lumen
GO:0031982	0.526	vesicle
GO:0043233	0.501	organelle lumen
GO:0005634	0.500	nucleus
GO:0070013	0.494	intracellular organelle lumen
GO:0032991	0.476	protein-containing complex
GO:0036477	0.363	somatodendritic compartment
GO:0043005	0.321	neuron projection
GO:0005576	0.317	extracellular region

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]