StarFunc result for job id Q92870

User Input

>input (758 residues)
MSEVLPADSGVDTLAVFMASSGTTDVTNRNSPATPPNTLNLRSSHNELLNAEIKHTETKN
STPPKCRKKYALTNIQAAMGLSDPAAQPLLGNGSANIKLVKNGENQLRKAAEQGQQDPNK
NLSPTAVINITSEKLEGKEPHPQDSSSCEILPSQPRRTKSFLNYYADLETSARELEQNRG
NHHGTAEEKSQPVQGQASTIIGNGDLLLQKPNRPQSSPEDGQVATVSSSPETKKDHPKTG
AKTDCALHRIQNLAPSDEESSWTTLSQDSASPSSPDETDIWSDHSFQTDPDLPPGWKRVS
DIAGTYYWHIPTGTTQWERPVSIPADLQGSRKGSLSSVTPSPTPENEKQPWSDFAVLNGG
KINSDIWKDLHAATVNPDPSLKEFEGATLRYASLKLRNAPHPDDDDSCSINSDPEAKCFA
VRSLGWVEMAEEDLAPGKSSVAVNNCIRQLSYCKNDIRDTVGIWGEGKDMYLILENDMLS
LVDPMDRSVLHSQPIVSIRVWGVGRDNGRDFAYVARDKDTRILKCHVFRCDTPAKAIATS
LHEICSKIMAERKNAKALACSSLQERANVNLDVPLQVDFPTPKTELVQKFHVQYLGMLPV
DKPVGMDILNSAIENLMTSSNKEDWLSVNMNVADATVTVISEKNEEEVLVECRVRFLSFM
GVGKDVHTFAFIMDTGNQRFECHVFWCEPNAGNVSEAVQAACMLRYQKCLVARPPSQKVR
PPPPPADSVTRRVTTNVKRGVLSLIDTLKQKRPVTEMP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9DBR4	0.619	0.617	0.000	760	0.941	0.938	Q9DBR4.pdb.gz	APBB2_MOUSE Amyloid beta precursor protein binding family B member 2 OS=Mus musculus OX=10090 GN=Apbb2 PE=1 SV=2
2	AFDB:Q13387	0.177	0.163	1.738E-10	824	0.152	0.140	Q13387.pdb.gz	JIP2_HUMAN C-Jun-amino-terminal kinase-interacting protein 2 OS=Homo sapiens OX=9606 GN=MAPK8IP2 PE=1 SV=2
3	AFDB:Q9UQF2	0.166	0.176	1.120E-9	711	0.164	0.174	Q9UQF2.pdb.gz	JIP1_HUMAN C-Jun-amino-terminal kinase-interacting protein 1 OS=Homo sapiens OX=9606 GN=MAPK8IP1 PE=1 SV=1
4	AFDB:Q9VGI1	0.128	0.083	3.739E-8	1354	0.128	0.072	Q9VGI1.pdb.gz	Q9VGI1_DROME FI23955p1 OS=Drosophila melanogaster OX=7227 GN=prd1 PE=2 SV=1
5	AFDB:A0A3B3ISP1	0.158	0.101	7.217E-8	1194	0.168	0.106	A0A3B3ISP1.pdb.gz	A0A3B3ISP1_HUMAN Ankyrin repeat and sterile alpha motif domain containing 1A OS=Homo sapiens OX=9606 GN=ANKS1A PE=1 SV=1
6	PDB:7c3mA	0.101	0.131	2.660E-6	577	0.050	0.066	7c3mA.pdb.gz
7	AFDB:Q9W2S5	0.166	0.066	3.168E-6	2139	0.146	0.052	Q9W2S5.pdb.gz	Q9W2S5_DROME X11Lbeta, isoform A OS=Drosophila melanogaster OX=7227 GN=X11Lbeta PE=1 SV=5
8	AFDB:P38800	0.113	0.068	6.112E-5	1345	0.132	0.074	P38800.pdb.gz	LAM4_YEAST Membrane-anchored lipid-binding protein LAM4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=LAM4 PE=1 SV=1
9	PDB:6xtbE	0.118	0.322	1.303E-4	235	0.045	0.145	6xtbE.pdb.gz
10	PDB:6upkH	0.102	0.169	2.657E-4	411	0.041	0.075	6upkH.pdb.gz	FACT caught in the act of manipulating the nucleosome.
11	PDB:3ljuX	0.117	0.202	3.494E-4	373	0.033	0.067	3ljuX.pdb.gz	Phosphorylation-independent dual-site binding of the FHA domain of KIF13 mediates phosphoinositide transport via centaurin alpha1.
12	AFDB:F4JHM9	0.065	0.035	4.162E-4	1913	0.125	0.050	F4JHM9.pdb.gz	F4JHM9_ARATH Transducin family protein / WD-40 repeat family protein OS=Arabidopsis thaliana OX=3702 GN=SETH5 PE=1 SV=1
13	PDB:7nkyQ	0.088	0.154	1.167E-3	404	0.042	0.079	7nkyQ.pdb.gz	Structural basis of nucleosome transcription mediated by Chd1 and FACT.
14	PDB:7r04B	0.109	0.040	1.535E-3	2229	0.022	0.008	7r04B.pdb.gz	Structural basis of activation of the tumor suppressor protein neurofibromin.
15	PDB:4mk0A	0.118	0.140	1.621E-3	631	0.032	0.038	4mk0A.pdb.gz	Structural and functional analysis of g protein-coupled receptor kinase inhibition by paroxetine and a rationally designed analog.
16	PDB:7mp5A	0.108	0.052	1.911E-3	1629	0.021	0.010	7mp5A.pdb.gz
17	PDB:7r04A	0.109	0.038	2.132E-3	2326	0.025	0.008	7r04A.pdb.gz	Structural basis of activation of the tumor suppressor protein neurofibromin.
18	PDB:4gouA	0.104	0.149	2.804E-3	507	0.028	0.041	4gouA.pdb.gz
19	AFDB:Q9H2D6	0.117	0.043	2.834E-3	2365	0.124	0.040	Q9H2D6.pdb.gz	TARA_HUMAN TRIO and F-actin-binding protein OS=Homo sapiens OX=9606 GN=TRIOBP PE=1 SV=3
20	AFDB:Q99KW3	0.114	0.049	4.902E-3	2014	0.148	0.056	Q99KW3.pdb.gz	TARA_MOUSE TRIO and F-actin-binding protein OS=Mus musculus OX=10090 GN=Triobp PE=1 SV=3

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O00213	0.0	582	710	0.456	0.487	APBB1_HUMAN Amyloid beta precursor protein binding family B member 1 OS=Homo sapiens OX=9606 GN=APBB1 PE=1 SV=2
2	P46933	0.0	599	711	0.463	0.494	APBB1_RAT Amyloid beta precursor protein binding family B member 1 OS=Rattus norvegicus OX=10116 GN=Apbb1 PE=1 SV=3
3	Q92870	0.0	1574	758	1.000	1.000	APBB2_HUMAN Amyloid beta precursor protein binding family B member 2 OS=Homo sapiens OX=9606 GN=APBB2 PE=1 SV=3
4	Q9DBR4	0.0	1476	760	0.942	0.939	APBB2_MOUSE Amyloid beta precursor protein binding family B member 2 OS=Mus musculus OX=10090 GN=Apbb2 PE=1 SV=2
5	Q9QXJ1	0.0	597	710	0.463	0.494	APBB1_MOUSE Amyloid beta precursor protein binding family B member 1 OS=Mus musculus OX=10090 GN=Apbb1 PE=1 SV=3
6	O95704	1.01e-123	380	486	0.270	0.422	APBB3_HUMAN Amyloid-beta A4 precursor protein-binding family B member 3 OS=Homo sapiens OX=9606 GN=APBB3 PE=1 SV=2
7	Q8R1C9	1.40e-122	378	486	0.268	0.418	APBB3_MOUSE Amyloid-beta A4 precursor protein-binding family B member 3 OS=Mus musculus OX=10090 GN=Apbb3 PE=2 SV=1
8	O35827	8.52e-121	374	504	0.255	0.383	APBB3_RAT Amyloid-beta A4 precursor protein-binding family B member 3 OS=Rattus norvegicus OX=10116 GN=Apbb3 PE=1 SV=1
9	V9GY97	1.40e-91	289	261	0.195	0.567	V9GY97_HUMAN Amyloid beta precursor protein binding family B member 1 (Fragment) OS=Homo sapiens OX=9606 GN=APBB1 PE=1 SV=8
10	D6RBA1	6.77e-80	261	337	0.182	0.409	D6RBA1_HUMAN Amyloid beta precursor protein binding family B member 3 OS=Homo sapiens OX=9606 GN=APBB3 PE=1 SV=2
11	E7EX91	6.66e-78	256	339	0.182	0.407	E7EX91_HUMAN Amyloid beta precursor protein binding family B member 3 OS=Homo sapiens OX=9606 GN=APBB3 PE=1 SV=1
12	Q9BKZ9	8.87e-76	260	665	0.168	0.191	FEH1_CAEEL Protein Fe65 homolog OS=Caenorhabditis elegans OX=6239 GN=feh-1 PE=1 SV=2
13	Q3MUI1	2.26e-04	47.0	592	0.049	0.062	Q3MUI1_RAT Numb OS=Rattus norvegicus OX=10116 GN=Numb PE=1 SV=1
14	Q9UQF2	2.89e-04	46.6	711	0.047	0.051	JIP1_HUMAN C-Jun-amino-terminal kinase-interacting protein 1 OS=Homo sapiens OX=9606 GN=MAPK8IP1 PE=1 SV=1
15	A0A0R4IDU4	2.95e-04	46.6	618	0.046	0.057	A0A0R4IDU4_DANRE NUMB-like endocytic adaptor protein OS=Danio rerio OX=7955 GN=z-numb PE=4 SV=1
16	A0A286Y8T8	3.14e-04	46.6	640	0.046	0.055	A0A286Y8T8_DANRE NUMB-like endocytic adaptor protein OS=Danio rerio OX=7955 GN=z-numb PE=4 SV=1
17	E9PBB9	3.14e-04	46.6	701	0.047	0.051	E9PBB9_HUMAN Mitogen-activated protein kinase 8 interacting protein 1 OS=Homo sapiens OX=9606 GN=MAPK8IP1 PE=1 SV=1
18	Q9R237	3.86e-04	46.2	708	0.046	0.049	JIP1_RAT C-Jun-amino-terminal kinase-interacting protein 1 OS=Rattus norvegicus OX=10116 GN=Mapk8ip1 PE=1 SV=2
19	F1LIN5	6.65e-04	45.4	535	0.044	0.062	F1LIN5_CAEEL PID domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=num-1 PE=1 SV=1
20	Q9XTY6	7.07e-04	45.4	593	0.044	0.056	NUMB1_CAEEL Numb-related protein 1 OS=Caenorhabditis elegans OX=6239 GN=num-1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00640 PID	1.6e-47	172.5	Phosphotyrosine interaction domain (PTB/PID)
2	PF08416 PTB	0.36	22.3	Phosphotyrosine-binding domain
3	PF00397 WW	0.00017	32.9	WW domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000427211

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000284981	0.974	Amyloid-beta A4 protein
2	9606.ENSP00000263574	0.914	Amyloid-like protein 2
3	9606.ENSP00000221891	0.887	Amyloid-like protein 1
4	9606.ENSP00000453293	0.795	Amyloid-beta A4 precursor protein-binding family A member 2
5	9606.ENSP00000265381	0.771	Amyloid-beta A4 precursor protein-binding family A member 1
6	9606.ENSP00000275493	0.695	Epidermal growth factor receptor
7	9606.ENSP00000477213	0.695	Amyloid-beta A4 precursor protein-binding family B member 1
8	9606.ENSP00000250237	0.628	Queuine tRNA-ribosyltransferase catalytic subunit 1
9	9606.ENSP00000357973	0.614	AFG1-like ATPase
10	9606.ENSP00000446278	0.612	Leucine rich repeats and transmembrane domains 2
11	9606.ENSP00000246190	0.605	N-terminal EF-hand calcium-binding protein 3
12	9606.ENSP00000375067	0.597	Breast carcinoma-amplified sequence 3
13	9606.ENSP00000384999	0.584	Prolyl 4-hydroxylase subunit alpha-2
14	9606.ENSP00000359892	0.575	Choline transporter-like protein 5
15	9606.ENSP00000343126	0.546	AT-rich interactive domain-containing protein 3B
16	9606.ENSP00000362399	0.519	Syntaxin-binding protein 1
17	9606.ENSP00000264436	0.515	Beta-adducin
18	9606.ENSP00000267807	0.506	Zinc finger protein 280D

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0019899	0.312	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.995	regulation of cellular process
GO:0009987	0.981	cellular process
GO:0051171	0.970	regulation of nitrogen compound metabolic process
GO:0031323	0.970	regulation of cellular metabolic process
GO:0080090	0.969	regulation of primary metabolic process
GO:0060255	0.966	regulation of macromolecule metabolic process
GO:0010556	0.957	regulation of macromolecule biosynthetic process
GO:0031326	0.957	regulation of cellular biosynthetic process
GO:0010468	0.954	regulation of gene expression
GO:0048523	0.948	negative regulation of cellular process
GO:0051252	0.947	regulation of RNA metabolic process
GO:0048522	0.935	positive regulation of cellular process
GO:0050896	0.842	response to stimulus
GO:0006355	0.840	regulation of DNA-templated transcription
GO:0006357	0.820	regulation of transcription by RNA polymerase II
GO:0009892	0.736	negative regulation of metabolic process
GO:0009893	0.716	positive regulation of metabolic process
GO:0071840	0.701	cellular component organization or biogenesis
GO:0051173	0.691	positive regulation of nitrogen compound metabolic process
GO:0010604	0.689	positive regulation of macromolecule metabolic process
GO:0016043	0.670	cellular component organization
GO:0051726	0.657	regulation of cell cycle
GO:0032502	0.645	developmental process
GO:0048856	0.644	anatomical structure development
GO:0032501	0.639	multicellular organismal process
GO:0031324	0.604	negative regulation of cellular metabolic process
GO:0007275	0.593	multicellular organism development
GO:0042221	0.574	response to chemical
GO:0031325	0.539	positive regulation of cellular metabolic process
GO:0051172	0.497	negative regulation of nitrogen compound metabolic process
GO:0010557	0.482	positive regulation of macromolecule biosynthetic process
GO:0010605	0.478	negative regulation of macromolecule metabolic process
GO:0051254	0.475	positive regulation of RNA metabolic process
GO:0048731	0.473	system development
GO:0045893	0.471	positive regulation of DNA-templated transcription
GO:0071704	0.467	organic substance metabolic process
GO:0010941	0.416	regulation of cell death
GO:1903507	0.405	negative regulation of nucleic acid-templated transcription
GO:0045892	0.404	negative regulation of DNA-templated transcription
GO:0044238	0.403	primary metabolic process
GO:0042981	0.396	regulation of apoptotic process
GO:0045944	0.384	positive regulation of transcription by RNA polymerase II
GO:0000122	0.376	negative regulation of transcription by RNA polymerase II
GO:0051716	0.356	cellular response to stimulus
GO:0006807	0.354	nitrogen compound metabolic process
GO:1901987	0.332	regulation of cell cycle phase transition

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043231	0.998	intracellular membrane-bounded organelle
GO:0012505	0.995	endomembrane system
GO:0005634	0.991	nucleus
GO:0031982	0.937	vesicle
GO:0031410	0.926	cytoplasmic vesicle
GO:0005794	0.914	Golgi apparatus
GO:0016020	0.863	membrane
GO:0005783	0.535	endoplasmic reticulum
GO:0005768	0.453	endosome
GO:0005829	0.335	cytosol
GO:0005769	0.321	early endosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]