StarFunc result for job id Q92878

User Input

>input (1312 residues)
MSRIEKMSILGVRSFGIEDKDKQIITFFSPLTILVGPNGAGKTTIIECLKYICTGDFPPG
TKGNTFVHDPKVAQETDVRAQIRLQFRDVNGELIAVQRSMVCTQKSKKTEFKTLEGVITR
TKHGEKVSLSSKCAEIDREMISSLGVSKAVLNNVIFCHQEDSNWPLSEGKALKQKFDEIF
SATRYIKALETLRQVRQTQGQKVKEYQMELKYLKQYKEKACEIRDQITSKEAQLTSSKEI
VKSYENELDPLKNRLKEIEHNLSKIMKLDNEIKALDSRKKQMEKDNSELEEKMEKVFQGT
DEQLNDLYHNHQRTVREKERKLVDCHRELEKLNKESRLLNQEKSELLVEQGRLQLQADRH
QEHIRARDSLIQSLATQLELDGFERGPFSERQIKNFHKLVRERQEGEAKTANQLMNDFAE
KETLKQKQIDEIRDKKTGLGRIIELKSEILSKKQNELKNVKYELQQLEGSSDRILELDQE
LIKAERELSKAEKNSNVETLKMEVISLQNEKADLDRTLRKLDQEMEQLNHHTTTRTQMEM
LTKDKADKDEQIRKIKSRHSDELTSLLGYFPNKKQLEDWLHSKSKEINQTRDRLAKLNKE
LASSEQNKNHINNELKRKEEQLSSYEDKLFDVCGSQDFESDLDRLKEEIEKSSKQRAMLA
GATAVYSQFITQLTDENQSCCPVCQRVFQTEAELQEVISDLQSKLRLAPDKLKSTESELK
KKEKRRDEMLGLVPMRQSIIDLKEKEIPELRNKLQNVNRDIQRLKNDIEEQETLLGTIMP
EEESAKVCLTDVTIMERFQMELKDVERKIAQQAAKLQGIDLDRTVQQVNQEKQEKQHKLD
TVSSKIELNRKLIQDQQEQIQHLKSTTNELKSEKLQISTNLQRRQQLEEQTVELSTEVQS
LYREIKDAKEQVSPLETTLEKFQQEKEELINKKNTSNKIAQDKLNDIKEKVKNIHGYMKD
IENYIQDGKDDYKKQKETELNKVIAQLSECEKHKEKINEDMRLMRQDIDTQKIQERWLQD
NLTLRKRNEELKEVEEERKQHLKEMGQMQVLQMKSEHQKLEENIDNIKRNHNLALGRQKG
YEEEIIHFKKELREPQFRDAEEKYREMMIVMRTTELVNKDLDIYYKTLDQAIMKFHSMKM
EEINKIIRDLWRSTYRGQDIEYIEIRSDADENVSASDKRRNYNYRVVMLKGDTALDMRGR
CSAGQKVLASLIIRLALAETFCLNCGIIALDEPTTNLDRENIESLAHALVEIIKSRSQQR
NFQLLVITHDEDFVELLGRSEYVEKFYRIKKNIDQCSEIVKCSVSSLGFNVH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P70388	0.375	0.375	0.000	1312	0.922	0.922	P70388.pdb.gz	RAD50_MOUSE DNA repair protein RAD50 OS=Mus musculus OX=10090 GN=Rad50 PE=1 SV=1
2	AFDB:Q5W4T6	0.336	0.352	0.000	1250	0.727	0.763	Q5W4T6.pdb.gz	Q5W4T6_CHICK RAD50 protein (Fragment) OS=Gallus gallus OX=9031 GN=RAD50 PE=3 SV=1
3	AFDB:Q9SL02	0.363	0.362	2.719E-84	1316	0.294	0.293	Q9SL02.pdb.gz	RAD50_ARATH DNA repair protein RAD50 OS=Arabidopsis thaliana OX=3702 GN=RAD50 PE=1 SV=2
4	AFDB:Q9W252	0.364	0.362	1.031E-82	1318	0.274	0.273	Q9W252.pdb.gz	RAD50_DROME DNA repair protein RAD50 OS=Drosophila melanogaster OX=7227 GN=rad50 PE=2 SV=4
5	AFDB:A0A1D8PJD1	0.341	0.336	1.225E-80	1332	0.262	0.258	A0A1D8PJD1.pdb.gz	A0A1D8PJD1_CANAL MRX complex DNA-binding subunit OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=RAD50 PE=4 SV=1
6	AFDB:Q9UTJ8	0.350	0.357	2.168E-80	1285	0.269	0.275	Q9UTJ8.pdb.gz	RAD50_SCHPO DNA repair protein rad50 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rad50 PE=1 SV=3
7	AFDB:P12753	0.364	0.364	3.228E-79	1312	0.266	0.266	P12753.pdb.gz	RAD50_YEAST DNA repair protein RAD50 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RAD50 PE=1 SV=1
8	AFDB:Q384J8	0.386	0.376	1.586E-77	1349	0.269	0.262	Q384J8.pdb.gz	Q384J8_TRYB2 RAD50 DNA repair-like protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.0340 PE=4 SV=1
9	AFDB:Q9X0R4	0.229	0.255	3.988E-32	1170	0.170	0.191	Q9X0R4.pdb.gz	Q9X0R4_THEMA Chromosome partition protein Smc OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=smc PE=1 SV=1
10	AFDB:Q8TZY2	0.273	0.302	1.070E-31	1177	0.161	0.179	Q8TZY2.pdb.gz	SMC_PYRFU Chromosome partition protein Smc OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) OX=186497 GN=smc PE=1 SV=2
11	PDB:6yvuB	0.213	0.233	1.865E-24	1191	0.143	0.157	6yvuB.pdb.gz
12	PDB:7qcdA	0.181	0.226	1.538E-16	1028	0.126	0.161	7qcdA.pdb.gz	Cryo-EM structure of the Smc5/6 holo-complex.
13	PDB:6yvuA	0.165	0.189	3.409E-14	1127	0.131	0.153	6yvuA.pdb.gz
14	PDB:7qcdB	0.231	0.292	2.864E-10	998	0.130	0.170	7qcdB.pdb.gz	Cryo-EM structure of the Smc5/6 holo-complex.
15	PDB:6wg3A	0.128	0.278	7.041E-8	561	0.026	0.061	6wg3A.pdb.gz	Cryo-EM structure of the human cohesin-NIPBL-DNA complex.
16	PDB:7yzpC	0.124	0.330	1.313E-7	448	0.032	0.094	7yzpC.pdb.gz	Structural mechanism of endonucleolytic processing of blocked DNA ends and hairpins by Mre11-Rad50.
17	PDB:6yvvB	0.134	0.335	3.175E-7	480	0.030	0.081	6yvvB.pdb.gz
18	PDB:6wgeA	0.126	0.377	4.335E-7	390	0.030	0.103	6wgeA.pdb.gz	Cryo-EM structure of the human cohesin-NIPBL-DNA complex.
19	PDB:7qenB	0.125	0.362	8.969E-7	419	0.022	0.069	7qenB.pdb.gz	A hold-and-feed mechanism drives directional DNA loop extrusion by condensin.
20	PDB:7qenA	0.120	0.290	1.955E-6	465	0.027	0.075	7qenA.pdb.gz	A hold-and-feed mechanism drives directional DNA loop extrusion by condensin.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P70388	0.0	2480	1312	0.922	0.922	RAD50_MOUSE DNA repair protein RAD50 OS=Mus musculus OX=10090 GN=Rad50 PE=1 SV=1
2	Q5W4T6	0.0	1957	1250	0.729	0.765	Q5W4T6_CHICK RAD50 protein (Fragment) OS=Gallus gallus OX=9031 GN=RAD50 PE=3 SV=1
3	Q92878	0.0	2659	1312	1.000	1.000	RAD50_HUMAN DNA repair protein RAD50 OS=Homo sapiens OX=9606 GN=RAD50 PE=1 SV=1
4	Q9JIL8	0.0	2452	1312	0.921	0.921	RAD50_RAT DNA repair protein RAD50 OS=Rattus norvegicus OX=10116 GN=Rad50 PE=1 SV=1
5	Q9SL02	6.75e-165	530	1316	0.322	0.321	RAD50_ARATH DNA repair protein RAD50 OS=Arabidopsis thaliana OX=3702 GN=RAD50 PE=1 SV=2
6	Q9W252	2.34e-158	512	1318	0.299	0.297	RAD50_DROME DNA repair protein RAD50 OS=Drosophila melanogaster OX=7227 GN=rad50 PE=2 SV=4
7	A0A1D8PJD1	3.12e-135	450	1332	0.305	0.300	A0A1D8PJD1_CANAL MRX complex DNA-binding subunit OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=RAD50 PE=4 SV=1
8	P12753	6.32e-68	254	1312	0.161	0.161	RAD50_YEAST DNA repair protein RAD50 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RAD50 PE=1 SV=1
9	Q9UTJ8	1.43e-59	227	1285	0.082	0.083	RAD50_SCHPO DNA repair protein rad50 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rad50 PE=1 SV=3
10	Q384J8	2.24e-59	227	1349	0.080	0.078	Q384J8_TRYB2 RAD50 DNA repair-like protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.0340 PE=4 SV=1
11	Q9X1X1	9.20e-05	49.3	852	0.028	0.043	RAD50_THEMA Probable DNA double-strand break repair Rad50 ATPase OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=rad50 PE=1 SV=1
12	Q9X0R4	5.25e-04	47.0	1170	0.014	0.016	Q9X0R4_THEMA Chromosome partition protein Smc OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=smc PE=1 SV=1
13	E7F0X6	8.08e-04	46.6	1232	0.019	0.020	E7F0X6_DANRE Structural maintenance of chromosomes protein OS=Danio rerio OX=7955 GN=smc1a PE=3 SV=1
14	Q920F6	0.002	45.1	1248	0.050	0.052	SMC1B_MOUSE Structural maintenance of chromosomes protein 1B OS=Mus musculus OX=10090 GN=Smc1b PE=1 SV=1
15	Q6DRM9	0.005	43.9	1233	0.018	0.019	Q6DRM9_DANRE Structural maintenance of chromosomes protein OS=Danio rerio OX=7955 GN=im:7158706 PE=1 SV=1
16	Q8TZY2	0.005	43.9	1177	0.014	0.016	SMC_PYRFU Chromosome partition protein Smc OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) OX=186497 GN=smc PE=1 SV=2
17	O94383	0.009	43.1	1228	0.027	0.029	SMC1_SCHPO Structural maintenance of chromosomes protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=psm1 PE=1 SV=2
18	P10587	0.009	43.1	1979	0.037	0.024	MYH11_CHICK Myosin-11 OS=Gallus gallus OX=9031 GN=MYH11 PE=1 SV=4
19	O01789	0.011	42.7	1262	0.013	0.013	SMC1_CAEEL Structural maintenance of chromosomes protein 1 OS=Caenorhabditis elegans OX=6239 GN=him-1 PE=1 SV=4
20	Q8NDV3	0.015	42.4	1235	0.017	0.018	SMC1B_HUMAN Structural maintenance of chromosomes protein 1B OS=Homo sapiens OX=9606 GN=SMC1B PE=2 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13175 AAA_15	4.4e-07	41.4	AAA ATPase domain
2	PF13191 AAA_16	7.7e+02	11.8	AAA ATPase domain
3	PF13304 AAA_21	0.015	26.7	AAA domain, putative AbiEii toxin, Type IV TA system
4	PF13476 AAA_23	7.4e-32	123.0	AAA domain
5	PF13555 AAA_29	45	15.2	P-loop containing region of AAA domain
6	PF19220 Crescentin	2.8	18.5	Crescentin protein
7	PF10865 DUF2703	26	16.4	Domain of unknown function (DUF2703)
8	PF04423 Rad50_zn_hook	2.9e-09	47.9	Rad50 zinc hook motif
9	PF13558 SbcC_Walker_B	0.0021	29.6	SbcC/RAD50-like, Walker B motif
10	PF02463 SMC_N	0.03	25.3	RecF/RecN/SMC N terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000368100

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000265433	0.999	Nibrin
2	9606.ENSP00000325863	0.999	Double-strand break repair protein MRE11
3	9606.ENSP00000278616	0.996	Serine-protein kinase ATM
4	9606.ENSP00000418960	0.994	Breast cancer type 1 susceptibility protein
5	9606.ENSP00000365588	0.993	Mediator of DNA damage checkpoint protein 1
6	9606.ENSP00000300086	0.988	Telomeric repeat-binding factor 2-interacting protein 1
7	9606.ENSP00000354720	0.988	Structural maintenance of chromosomes protein 3
8	9606.ENSP00000254942	0.987	Telomeric repeat-binding factor 2
9	9606.ENSP00000434024	0.987	Histone H2AX
10	9606.ENSP00000352257	0.983	X-ray repair cross-complementing protein 6
11	9606.ENSP00000347232	0.979	Bloom syndrome protein
12	9606.ENSP00000371475	0.978	TP53-binding protein 1
13	9606.ENSP00000382628	0.977	DNA endonuclease RBBP8
14	9606.ENSP00000318977	0.975	Flap endonuclease GEN homolog 1
15	9606.ENSP00000360310	0.975	Meiotic recombination protein SPO11
16	9606.ENSP00000323421	0.973	Structural maintenance of chromosomes protein 1A
17	9606.ENSP00000343741	0.973	Serine/threonine-protein kinase ATR
18	9606.ENSP00000355506	0.972	Exonuclease 1
19	9606.ENSP00000372023	0.967	Serine/threonine-protein kinase Chk2
20	9606.ENSP00000351284	0.966	DNA repair protein RAD52 homolog

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:1901363	0.985	heterocyclic compound binding
GO:0097159	0.985	organic cyclic compound binding
GO:0003677	0.977	DNA binding
GO:0003824	0.545	catalytic activity
GO:0016787	0.441	hydrolase activity
GO:0140657	0.439	ATP-dependent activity
GO:0140640	0.357	catalytic activity, acting on a nucleic acid
GO:0140097	0.335	catalytic activity, acting on DNA

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044260	0.995	cellular macromolecule metabolic process
GO:0090304	0.995	nucleic acid metabolic process
GO:0050789	0.990	regulation of biological process
GO:0007049	0.990	cell cycle
GO:0051276	0.990	chromosome organization
GO:0006302	0.986	double-strand break repair
GO:0032200	0.981	telomere organization
GO:0050794	0.966	regulation of cellular process
GO:0006310	0.957	DNA recombination
GO:0000723	0.953	telomere maintenance
GO:0022402	0.952	cell cycle process
GO:0051321	0.916	meiotic cell cycle
GO:0007127	0.896	meiosis I
GO:0019222	0.619	regulation of metabolic process
GO:0048519	0.566	negative regulation of biological process
GO:0060255	0.547	regulation of macromolecule metabolic process
GO:0080090	0.545	regulation of primary metabolic process
GO:0051171	0.545	regulation of nitrogen compound metabolic process
GO:0031323	0.545	regulation of cellular metabolic process
GO:0035825	0.512	homologous recombination
GO:0140527	0.493	reciprocal homologous recombination
GO:0019219	0.444	regulation of nucleobase-containing compound metabolic process
GO:0051052	0.402	regulation of DNA metabolic process
GO:0048518	0.341	positive regulation of biological process
GO:0051726	0.339	regulation of cell cycle
GO:0048522	0.334	positive regulation of cellular process
GO:0048523	0.333	negative regulation of cellular process
GO:0007131	0.320	reciprocal meiotic recombination

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0032991	0.999	protein-containing complex
GO:0043232	0.999	intracellular non-membrane-bounded organelle
GO:0005694	0.993	chromosome
GO:0140513	0.981	nuclear protein-containing complex
GO:0005737	0.885	cytoplasm
GO:0098687	0.755	chromosomal region
GO:0016020	0.751	membrane
GO:0000781	0.655	chromosome, telomeric region
GO:0005829	0.504	cytosol
GO:0090734	0.369	site of DNA damage
GO:0000793	0.326	condensed chromosome
GO:0035861	0.311	site of double-strand break

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.-.-.-	0.441	Hydrolases.

[back to server]