StarFunc result for job id Q92879

User Input

>input (486 residues)
MNGTLDHPDQPDLDAIKMFVGQVPRTWSEKDLRELFEQYGAVYEINVLRDRSQNPPQSKG
CCFVTFYTRKAALEAQNALHNMKVLPGMHHPIQMKPADSEKNNAVEDRKLFIGMISKKCT
ENDIRVMFSSFGQIEECRILRGPDGLSRGCAFVTFTTRAMAQTAIKAMHQAQTMEGCSSP
MVVKFADTQKDKEQKRMAQQLQQQMQQISAASVWGNLAGLNTLGPQYLALYLQLLQQTAS
SGNLNTLSSLHPMGGLNAMQLQNLAALAAAASAAQNTPSGTNALTTSSSPLSVLTSSGSS
PSSSSSNSVNPIASLGALQTLAGATAGLNVGSLAGMAALNGGLGSSGLSNGTGSTMEALT
QAYSGIQQYAAAALPTLYNQNLLTQQSIGAAGSQKEGPEGANLFIYHLPQEFGDQDLLQM
FMPFGNVVSAKVFIDKQTNLSKCFGFVSYDNPVSAQAAIQSMNGFQIGMKRLKVQLKRSK
NDSKPY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:G5EA30	0.614	0.584	2.041E-84	514	1.000	0.946	G5EA30.pdb.gz	G5EA30_HUMAN CUG triplet repeat, RNA binding protein 1, isoform CRA_c OS=Homo sapiens OX=9606 GN=CELF1 PE=1 SV=1
2	AFDB:Q9IBD0	0.558	0.545	2.632E-77	501	0.874	0.848	Q9IBD0.pdb.gz	CELF1_DANRE CUGBP Elav-like family member 1 OS=Danio rerio OX=7955 GN=celf1 PE=1 SV=1
3	AFDB:A0A0J9YXJ0	0.409	0.374	1.619E-71	533	0.807	0.735	A0A0J9YXJ0.pdb.gz	A0A0J9YXJ0_HUMAN CUGBP Elav-like family member 2 OS=Homo sapiens OX=9606 GN=CELF2 PE=1 SV=1
4	AFDB:G5EF03	0.248	0.215	3.334E-48	584	0.471	0.392	G5EF03.pdb.gz	G5EF03_CAEEL ELAV-type RNA binding protein variant A OS=Caenorhabditis elegans OX=6239 GN=etr-1 PE=1 SV=1
5	AFDB:Q8LFS6	0.337	0.367	1.743E-40	441	0.307	0.338	Q8LFS6.pdb.gz	BRN1L_ARATH RNA-binding protein BRN1 OS=Arabidopsis thaliana OX=3702 GN=BRN1 PE=2 SV=1
6	AFDB:F4I0X0	0.247	0.270	2.388E-39	438	0.298	0.331	F4I0X0.pdb.gz	F4I0X0_ARATH RNA-binding (RRM/RBD/RNP motifs) family protein OS=Arabidopsis thaliana OX=3702 GN=BRN2 PE=1 SV=1
7	AFDB:Q9VU91	0.204	0.233	1.340E-36	422	0.358	0.412	Q9VU91.pdb.gz	Q9VU91_DROME Bruno 3, isoform A OS=Drosophila melanogaster OX=7227 GN=bru3 PE=2 SV=2
8	AFDB:M9MS33	0.217	0.261	1.513E-36	396	0.335	0.412	M9MS33.pdb.gz	M9MS33_DROME Bruno 3, isoform C OS=Drosophila melanogaster OX=7227 GN=bru3 PE=4 SV=1
9	AFDB:Q8IDB7	0.265	0.257	9.305E-31	509	0.270	0.257	Q8IDB7.pdb.gz	Q8IDB7_PLAF7 CUGBP Elav-like family member 1 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1359400 PE=4 SV=1
10	AFDB:M9MS39	0.189	0.248	7.994E-28	370	0.292	0.384	M9MS39.pdb.gz	M9MS39_DROME Bruno 3, isoform M OS=Drosophila melanogaster OX=7227 GN=bru3 PE=4 SV=1
11	PDB:5vsuA	0.156	0.192	8.929E-12	387	0.111	0.140	5vsuA.pdb.gz	Architecture of the U6 snRNP reveals specific recognition of 3'-end processed U6 snRNA.
12	PDB:6y53o	0.154	0.454	1.641E-11	160	0.107	0.325	6y53o.pdb.gz	Molecular architecture of the human 17S U2 snRNP.
13	PDB:6r5kH	0.172	0.205	4.089E-11	394	0.175	0.216	6r5kH.pdb.gz	Molecular Basis for poly(A) RNP Architecture and Recognition by the Pan2-Pan3 Deadenylase.
14	PDB:7oqcF	0.160	0.274	5.544E-11	267	0.103	0.187	7oqcF.pdb.gz	Structural insights into how Prp5 proofreads the pre-mRNA branch site.
15	PDB:5lsbA	0.171	0.412	9.114E-10	176	0.082	0.227	5lsbA.pdb.gz
16	PDB:7evoD	0.155	0.365	7.671E-9	200	0.068	0.165	7evoD.pdb.gz	Structural Insights into Branch Site Proofreading by Human Spliceosome.
17	PDB:6y5qq	0.159	0.401	1.040E-8	178	0.064	0.174	6y5qq.pdb.gz	Molecular architecture of the human 17S U2 snRNP.
18	PDB:6gd1A	0.163	0.408	7.750E-8	190	0.076	0.195	6gd1A.pdb.gz
19	PDB:6ff7X	0.135	0.334	1.117E-7	171	0.076	0.216	6ff7X.pdb.gz	Structure and Conformational Dynamics of the Human Spliceosomal BactComplex.
20	PDB:5yzg1	0.158	0.312	3.340E-7	243	0.047	0.095	5yzg1.pdb.gz	Structure of a human catalytic step I spliceosome

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0J9YXJ0	0.0	739	533	0.807	0.735	A0A0J9YXJ0_HUMAN CUGBP Elav-like family member 2 OS=Homo sapiens OX=9606 GN=CELF2 PE=1 SV=1
2	G5EA30	0.0	996	514	1.000	0.946	G5EA30_HUMAN CUG triplet repeat, RNA binding protein 1, isoform CRA_c OS=Homo sapiens OX=9606 GN=CELF1 PE=1 SV=1
3	O95319	0.0	751	508	0.807	0.772	CELF2_HUMAN CUGBP Elav-like family member 2 OS=Homo sapiens OX=9606 GN=CELF2 PE=1 SV=1
4	P28659	0.0	999	486	0.996	0.996	CELF1_MOUSE CUGBP Elav-like family member 1 OS=Mus musculus OX=10090 GN=Celf1 PE=1 SV=2
5	Q4QQT3	0.0	993	487	0.994	0.992	CELF1_RAT CUGBP Elav-like family member 1 OS=Rattus norvegicus OX=10116 GN=Celf1 PE=2 SV=1
6	Q5VZZ6	0.0	739	502	0.807	0.781	Q5VZZ6_HUMAN CUGBP Elav-like family member 2 OS=Homo sapiens OX=9606 GN=CELF2 PE=1 SV=2
7	Q792H5	0.0	749	508	0.805	0.770	CELF2_RAT CUGBP Elav-like family member 2 OS=Rattus norvegicus OX=10116 GN=Celf2 PE=2 SV=1
8	Q7T2T1	0.0	735	484	0.782	0.785	CELF2_CHICK CUGBP Elav-like family member 2 OS=Gallus gallus OX=9031 GN=CELF2 PE=1 SV=2
9	Q92879	0.0	1001	486	1.000	1.000	CELF1_HUMAN CUGBP Elav-like family member 1 OS=Homo sapiens OX=9606 GN=CELF1 PE=1 SV=2
10	Q9IBD0	0.0	744	501	0.860	0.834	CELF1_DANRE CUGBP Elav-like family member 1 OS=Danio rerio OX=7955 GN=celf1 PE=1 SV=1
11	Q9Z0H4	0.0	749	508	0.805	0.770	CELF2_MOUSE CUGBP Elav-like family member 2 OS=Mus musculus OX=10090 GN=Celf2 PE=1 SV=1
12	V9GYD9	0.0	619	440	0.712	0.786	V9GYD9_HUMAN CUGBP Elav-like family member 2 OS=Homo sapiens OX=9606 GN=CELF2 PE=1 SV=1
13	Q8IP89	1.51e-132	399	620	0.498	0.390	Q8IP89_DROME Bruno 1, isoform F OS=Drosophila melanogaster OX=7227 GN=bru1 PE=3 SV=2
14	O02374	2.74e-132	397	604	0.510	0.411	O02374_DROME Bruno OS=Drosophila melanogaster OX=7227 GN=bru1 PE=2 SV=1
15	M9PDB0	2.95e-132	396	573	0.510	0.433	M9PDB0_DROME Bruno 1, isoform H OS=Drosophila melanogaster OX=7227 GN=bru1 PE=3 SV=1
16	Q960Z4	8.71e-132	396	604	0.510	0.411	Q960Z4_DROME Bruno 1, isoform A OS=Drosophila melanogaster OX=7227 GN=bru1 PE=2 SV=1
17	O18409	2.01e-130	399	808	0.506	0.304	O18409_DROME Testis-specific RNP-type RNA binding protein OS=Drosophila melanogaster OX=7227 GN=bru1 PE=1 SV=1
18	Q5SZQ8	5.49e-130	387	465	0.453	0.473	CELF3_HUMAN CUGBP Elav-like family member 3 OS=Homo sapiens OX=9606 GN=CELF3 PE=1 SV=1
19	Q8IP90	1.96e-129	396	810	0.510	0.306	Q8IP90_DROME Bruno 1, isoform B OS=Drosophila melanogaster OX=7227 GN=bru1 PE=2 SV=1
20	Q8CIN6	2.37e-129	385	465	0.451	0.471	CELF3_MOUSE CUGBP Elav-like family member 3 OS=Mus musculus OX=10090 GN=Celf3 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07576 BRAP2	15	17.2	BRCA1-associated protein 2
2	PF14605 Nup35_RRM_2	6.4	18.2	Nup53/35/40-type RNA recognition motif
3	PF14703 PHM7_cyt	1.7e+02	13.9	Cytosolic domain of 10TM putative phosphate transporter
4	PF08675 RNA_bind	9e-06	37.0	RNA binding domain
5	PF00076 RRM_1	1.7e-48	173.7	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
6	PF13893 RRM_5	0.081	24.0	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
7	PF16367 RRM_7	0.0032	28.9	RNA recognition motif

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 43179.ENSSTOP00000000556

Rank	PPI partner	STRING score	Description
1	43179.ENSSTOP00000019776	0.764	Heterogeneous nuclear ribonucleoprotein H2 (H')
2	43179.ENSSTOP00000023011	0.751	Muscleblind-like splicing regulator 1
3	43179.ENSSTOP00000014665	0.745	Heterogeneous nuclear ribonucleoprotein H1 (H)
4	43179.ENSSTOP00000006730	0.733	poly(A)-specific ribonuclease
5	43179.ENSSTOP00000011781	0.706	Muscleblind-like splicing regulator 2
6	43179.ENSSTOP00000006007	0.691	Muscleblind-like splicing regulator 3
7	43179.ENSSTOP00000015839	0.675	CCAAT/enhancer binding protein (C/EBP), delta
8	43179.ENSSTOP00000001355	0.663	Dystrophia myotonica-protein kinase
9	43179.ENSSTOP00000001402	0.652	Eukaryotic translation initiation factor 2, subunit 1 alpha, 35kDa
10	43179.ENSSTOP00000015664	0.628	RNA binding motif protein 24
11	43179.ENSSTOP00000007897	0.615	RALY heterogeneous nuclear ribonucleoprotein
12	43179.ENSSTOP00000015800	0.604	MOS proto-oncogene, serine/threonine kinase
13	43179.ENSSTOP00000000151	0.589	CCHC-type zinc finger, nucleic acid binding protein
14	43179.ENSSTOP00000013295	0.560	RNA binding protein fox-1 homolog
15	43179.ENSSTOP00000006740	0.558	Zinc finger, CW type with PWWP domain 1
16	43179.ENSSTOP00000000078	0.555	Purine-rich element binding protein A
17	43179.ENSSTOP00000010528	0.550	Polypyrimidine tract binding protein 2
18	43179.ENSSTOP00000015086	0.546	Cas scaffolding protein family member 4
19	43179.ENSSTOP00000013053	0.536	NME/NM23 family member 8
20	43179.ENSSTOP00000017144	0.532	Cytoplasmic polyadenylation element binding protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003729	1.000	mRNA binding
GO:0005515	0.992	protein binding
GO:0003730	0.963	mRNA 3'-UTR binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.988	cellular process
GO:0050789	0.988	regulation of biological process
GO:0050794	0.984	regulation of cellular process
GO:0060255	0.982	regulation of macromolecule metabolic process
GO:0080090	0.972	regulation of primary metabolic process
GO:0051171	0.966	regulation of nitrogen compound metabolic process
GO:0043170	0.960	macromolecule metabolic process
GO:0006807	0.959	nitrogen compound metabolic process
GO:0044238	0.958	primary metabolic process
GO:0031323	0.956	regulation of cellular metabolic process
GO:0008380	0.954	RNA splicing
GO:0016071	0.950	mRNA metabolic process
GO:0010468	0.924	regulation of gene expression
GO:0000375	0.917	RNA splicing, via transesterification reactions
GO:0071826	0.911	ribonucleoprotein complex subunit organization
GO:0000398	0.907	mRNA splicing, via spliceosome
GO:0051252	0.905	regulation of RNA metabolic process
GO:1903311	0.903	regulation of mRNA metabolic process
GO:0048518	0.891	positive regulation of biological process
GO:0000245	0.870	spliceosomal complex assembly
GO:0006376	0.820	mRNA splice site selection
GO:0048519	0.688	negative regulation of biological process
GO:0032501	0.668	multicellular organismal process
GO:0009892	0.650	negative regulation of metabolic process
GO:0032502	0.569	developmental process
GO:0048856	0.515	anatomical structure development
GO:0048522	0.488	positive regulation of cellular process
GO:0010605	0.477	negative regulation of macromolecule metabolic process
GO:0007275	0.454	multicellular organism development
GO:0048523	0.448	negative regulation of cellular process
GO:0009893	0.350	positive regulation of metabolic process
GO:0010604	0.343	positive regulation of macromolecule metabolic process
GO:0010629	0.334	negative regulation of gene expression
GO:0010608	0.330	post-transcriptional regulation of gene expression
GO:0050896	0.329	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0005737	0.985	cytoplasm
GO:0005654	0.926	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]