StarFunc result for job id Q92886

User Input

>input (237 residues)
MPARLETCISDLDCASSSGSDLSGFLTDEEDCARLQQAASASGPPAPARRGAPNISRASE
VPGAQDDEQERRRRRGRTRVRSEALLHSLRRSRRVKANDRERNRMHNLNAALDALRSVLP
SFPDDTKLTKIETLRFAYNYIWALAETLRLADQGLPGGGARERLLPPQCVPCLPGPPSPA
SDAESWGSGAAAASPLSDPSSPAASEDFTYRPGDPVFSFPSLPKDLLHTTPCFIPYH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q92886	1.000	1.000	3.297E-37	237	1.000	1.000	Q92886.pdb.gz	NGN1_HUMAN Neurogenin-1 OS=Homo sapiens OX=9606 GN=NEUROG1 PE=1 SV=2
2	AFDB:P70660	0.440	0.428	1.586E-28	244	0.903	0.877	P70660.pdb.gz	NGN1_MOUSE Neurogenin-1 OS=Mus musculus OX=10090 GN=Neurog1 PE=1 SV=1
3	AFDB:Q9H2A3	0.352	0.310	1.449E-10	272	0.384	0.335	Q9H2A3.pdb.gz	NGN2_HUMAN Neurogenin-2 OS=Homo sapiens OX=9606 GN=NEUROG2 PE=1 SV=2
4	AFDB:O08718	0.342	0.378	4.196E-9	214	0.388	0.430	O08718.pdb.gz	O08718_RAT Neurogenin 3 OS=Rattus norvegicus OX=10116 GN=Neurog3 PE=4 SV=1
5	AFDB:P70447	0.380	0.346	8.934E-9	263	0.405	0.365	P70447.pdb.gz	NGN2_MOUSE Neurogenin-2 OS=Mus musculus OX=10090 GN=Neurog2 PE=1 SV=1
6	AFDB:O16867	0.305	0.184	1.022E-6	398	0.316	0.188	O16867.pdb.gz	TAP_DROME Basic helix-loop-helix neural transcription factor TAP OS=Drosophila melanogaster OX=7227 GN=tap PE=1 SV=2
7	AFDB:Q7ZSX3	0.284	0.257	3.287E-6	265	0.253	0.226	Q7ZSX3.pdb.gz	PTF1A_DANRE Pancreas transcription factor 1 subunit alpha OS=Danio rerio OX=7955 GN=ptf1a PE=2 SV=1
8	AFDB:B3DH94	0.303	0.344	9.213E-6	206	0.241	0.277	B3DH94.pdb.gz	B3DH94_DANRE Atonal bHLH transcription factor 1b OS=Danio rerio OX=7955 GN=Atoh1.2 PE=2 SV=1
9	AFDB:Q7RTS3	0.264	0.196	9.868E-6	328	0.304	0.220	Q7RTS3.pdb.gz	PTF1A_HUMAN Pancreas transcription factor 1 subunit alpha OS=Homo sapiens OX=9606 GN=PTF1A PE=1 SV=1
10	AFDB:Q90XB3	0.278	0.224	9.868E-6	298	0.287	0.228	Q90XB3.pdb.gz	OLIG2_CHICK Oligodendrocyte transcription factor 2 OS=Gallus gallus OX=9031 GN=OLIG2 PE=2 SV=1
11	PDB:3tixA	0.130	0.187	2.939	153	0.025	0.039	3tixA.pdb.gz
12	PDB:6elzr	0.107	0.137	3.612	176	0.068	0.091	6elzr.pdb.gz	Visualizing the Assembly Pathway of Nucleolar Pre-60S Ribosomes.
13	PDB:7mqaNA	0.122	0.105	3.869	295	0.114	0.092	7mqaNA.pdb.gz	Nucleolar maturation of the human small subunit processome.
14	PDB:7mkoC	0.182	0.042	4.439	1320	0.059	0.011	7mkoC.pdb.gz	Structural basis of RNA polymerase recycling by the Swi2/Snf2 family of ATPase RapA in Escherichia coli.
15	PDB:6asyA	0.109	0.044	4.755	606	0.030	0.012	6asyA.pdb.gz	Conformation transitions of the polypeptide-binding pocket support an active substrate release from Hsp70s.
16	PDB:6lo8E	0.155	0.365	4.755	80	0.034	0.100	6lo8E.pdb.gz
17	PDB:6mdmH	0.114	0.164	5.093	147	0.076	0.122	6mdmH.pdb.gz	Structural principles of SNARE complex recognition by the AAA+ protein NSF.
18	PDB:7wfdAK	0.109	0.312	5.455	65	0.034	0.123	7wfdAK.pdb.gz	Supramolecular assembly of chloroplast NADH dehydrogenase-like complex with photosystem I from Arabidopsis thaliana.
19	PDB:3ojaA	0.251	0.134	6.258	482	0.042	0.021	3ojaA.pdb.gz	A heterodimeric complex of the LRR proteins LRIM1 and APL1C regulates complement-like immunity in Anopheles gambiae.
20	PDB:4q24A	0.113	0.119	7.180	224	0.059	0.062	4q24A.pdb.gz	Unravelling the mechanism of non-ribosomal peptide synthesis by cyclodipeptide synthases.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q92886	8.56e-172	474	237	1.000	1.000	NGN1_HUMAN Neurogenin-1 OS=Homo sapiens OX=9606 GN=NEUROG1 PE=1 SV=2
2	P70660	1.79e-116	334	244	0.873	0.848	NGN1_MOUSE Neurogenin-1 OS=Mus musculus OX=10090 GN=Neurog1 PE=1 SV=1
3	O42606	4.29e-49	162	208	0.451	0.514	NGN1_DANRE Neurogenin-1 OS=Danio rerio OX=7955 GN=neurog1 PE=2 SV=1
4	P70661	8.26e-40	138	214	0.359	0.397	NGN3_MOUSE Neurogenin-3 OS=Mus musculus OX=10090 GN=Neurog3 PE=1 SV=1
5	Q9Y4Z2	3.89e-39	136	214	0.380	0.421	NGN3_HUMAN Neurogenin-3 OS=Homo sapiens OX=9606 GN=NEUROG3 PE=1 SV=2
6	O08718	4.46e-37	131	214	0.270	0.299	O08718_RAT Neurogenin 3 OS=Rattus norvegicus OX=10116 GN=Neurog3 PE=4 SV=1
7	P70447	1.30e-32	121	263	0.253	0.228	NGN2_MOUSE Neurogenin-2 OS=Mus musculus OX=10090 GN=Neurog2 PE=1 SV=1
8	Q9H2A3	1.58e-29	113	272	0.316	0.276	NGN2_HUMAN Neurogenin-2 OS=Homo sapiens OX=9606 GN=NEUROG2 PE=1 SV=2
9	O16867	3.99e-23	98.6	398	0.203	0.121	TAP_DROME Basic helix-loop-helix neural transcription factor TAP OS=Drosophila melanogaster OX=7227 GN=tap PE=1 SV=2
10	O09105	2.84e-19	87.0	330	0.190	0.136	NDF4_MOUSE Neurogenic differentiation factor 4 OS=Mus musculus OX=10090 GN=Neurod4 PE=1 SV=1
11	D4A7M5	3.17e-19	86.7	330	0.190	0.136	D4A7M5_RAT Neurogenic differentiation factor OS=Rattus norvegicus OX=10116 GN=Neurod4 PE=4 SV=1
12	P48986	4.48e-19	86.7	337	0.181	0.128	NDF6_MOUSE Neurogenic differentiation factor 6 OS=Mus musculus OX=10090 GN=Neurod6 PE=2 SV=1
13	P79765	6.17e-19	86.3	357	0.169	0.112	NDF1_CHICK Neurogenic differentiation factor 1 OS=Gallus gallus OX=9031 GN=NEUROD1 PE=2 SV=1
14	Q60867	8.23e-19	85.9	357	0.169	0.112	NDF1_MOUSE Neurogenic differentiation factor 1 OS=Mus musculus OX=10090 GN=Neurod1 PE=1 SV=2
15	Q13562	8.32e-19	85.9	356	0.169	0.112	NDF1_HUMAN Neurogenic differentiation factor 1 OS=Homo sapiens OX=9606 GN=NEUROD1 PE=1 SV=3
16	Q64289	8.48e-19	85.9	357	0.169	0.112	NDF1_RAT Neurogenic differentiation factor 1 OS=Rattus norvegicus OX=10116 GN=Neurod1 PE=1 SV=1
17	Q9HD90	1.02e-18	85.5	331	0.266	0.190	NDF4_HUMAN Neurogenic differentiation factor 4 OS=Homo sapiens OX=9606 GN=NEUROD4 PE=1 SV=2
18	Q91616	1.52e-18	85.1	352	0.165	0.111	NDF1_XENLA Neurogenic differentiation factor 1 OS=Xenopus laevis OX=8355 GN=neurod1 PE=1 SV=1
19	Q6NYU3	1.58e-18	84.7	327	0.186	0.135	NDF6A_DANRE Neurogenic differentiation factor 6-A OS=Danio rerio OX=7955 GN=neurod6a PE=2 SV=1
20	Q15784	2.45e-18	84.7	382	0.169	0.105	NDF2_HUMAN Neurogenic differentiation factor 2 OS=Homo sapiens OX=9606 GN=NEUROD2 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00010 HLH	1.1e-12	59.0	Helix-loop-helix DNA-binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000317580

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000266744	0.809	Achaete-scute homolog 1
2	9606.ENSP00000352011	0.806	Voltage-dependent T-type calcium channel subunit alpha-1G
3	9606.ENSP00000352162	0.794	ELAV-like protein 3
4	9606.ENSP00000262367	0.765	CREB-binding protein
5	9606.ENSP00000404100	0.764	Paired box protein Pax-6
6	9606.ENSP00000299529	0.756	Cellular retinoic acid-binding protein 1
7	9606.ENSP00000382800	0.752	Runt-related transcription factor 3
8	9606.ENSP00000323588	0.705	Transcription factor SOX-2
9	9606.ENSP00000342626	0.696	Eyes absent homolog 1
10	9606.ENSP00000329418	0.689	Suppressor of cytokine signaling 1
11	9606.ENSP00000366413	0.684	POU domain, class 4, transcription factor 1
12	9606.ENSP00000231790	0.681	DNA mismatch repair protein Mlh1
13	9606.ENSP00000391826	0.681	Insulin-like growth factor II
14	9606.ENSP00000367714	0.678	Transcription factor HES-5
15	9606.ENSP00000344285	0.666	Brain-specific homeobox protein homolog
16	9606.ENSP00000230658	0.659	Insulin gene enhancer protein ISL-1
17	9606.ENSP00000380093	0.650	Transcription factor SOX-10
18	9606.ENSP00000417914	0.649	Ankyrin repeat and SOCS box protein 11
19	9606.ENSP00000247182	0.634	Homeobox protein SIX1
20	9606.ENSP00000297261	0.631	Sonic hedgehog protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0070888	1.000	E-box binding
GO:0003700	0.997	DNA-binding transcription factor activity
GO:0042802	0.757	identical protein binding
GO:0042803	0.711	protein homodimerization activity
GO:0000981	0.496	DNA-binding transcription factor activity, RNA polymerase II-specific

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032502	0.996	developmental process
GO:0032501	0.995	multicellular organismal process
GO:0048856	0.993	anatomical structure development
GO:0050794	0.989	regulation of cellular process
GO:0007275	0.982	multicellular organism development
GO:0019222	0.978	regulation of metabolic process
GO:0048731	0.973	system development
GO:0051171	0.966	regulation of nitrogen compound metabolic process
GO:0009889	0.958	regulation of biosynthetic process
GO:0010468	0.929	regulation of gene expression
GO:0019219	0.926	regulation of nucleobase-containing compound metabolic process
GO:0009987	0.924	cellular process
GO:0006355	0.917	regulation of DNA-templated transcription
GO:0006357	0.868	regulation of transcription by RNA polymerase II
GO:0007399	0.845	nervous system development
GO:0048513	0.768	animal organ development
GO:0048518	0.666	positive regulation of biological process
GO:0009653	0.650	anatomical structure morphogenesis
GO:0048522	0.643	positive regulation of cellular process
GO:0048869	0.536	cellular developmental process
GO:0030154	0.534	cell differentiation
GO:0010604	0.467	positive regulation of macromolecule metabolic process
GO:0050793	0.455	regulation of developmental process
GO:0051173	0.428	positive regulation of nitrogen compound metabolic process
GO:0031325	0.428	positive regulation of cellular metabolic process
GO:0031328	0.407	positive regulation of cellular biosynthetic process
GO:0010557	0.406	positive regulation of macromolecule biosynthetic process
GO:0051254	0.406	positive regulation of RNA metabolic process
GO:1903508	0.403	positive regulation of nucleic acid-templated transcription
GO:0050896	0.397	response to stimulus
GO:0045893	0.394	positive regulation of DNA-templated transcription
GO:0048519	0.385	negative regulation of biological process
GO:0048523	0.338	negative regulation of cellular process
GO:0045944	0.303	positive regulation of transcription by RNA polymerase II

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	0.999	nucleus
GO:0005737	0.816	cytoplasm
GO:0031981	0.347	nuclear lumen
GO:0032991	0.325	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]