StarFunc result for job id Q92887

User Input

>input (1545 residues)
MLEKFCNSTFWNSSFLDSPEADLPLCFEQTVLVWIPLGYLWLLAPWQLLHVYKSRTKRSS
TTKLYLAKQVFVGFLLILAAIELALVLTEDSGQATVPAVRYTNPSLYLGTWLLVLLIQYS
RQWCVQKNSWFLSLFWILSILCGTFQFQTLIRTLLQGDNSNLAYSCLFFISYGFQILILI
FSAFSENNESSNNPSSIASFLSSITYSWYDSIILKGYKRPLTLEDVWEVDEEMKTKTLVS
KFETHMKRELQKARRALQRRQEKSSQQNSGARLPGLNKNQSQSQDALVLEDVEKKKKKSG
TKKDVPKSWLMKALFKTFYMVLLKSFLLKLVNDIFTFVSPQLLKLLISFASDRDTYLWIG
YLCAILLFTAALIQSFCLQCYFQLCFKLGVKVRTAIMASVYKKALTLSNLARKEYTVGET
VNLMSVDAQKLMDVTNFMHMLWSSVLQIVLSIFFLWRELGPSVLAGVGVMVLVIPINAIL
STKSKTIQVKNMKNKDKRLKIMNEILSGIKILKYFAWEPSFRDQVQNLRKKELKNLLAFS
QLQCVVIFVFQLTPVLVSVVTFSVYVLVDSNNILDAQKAFTSITLFNILRFPLSMLPMMI
SSMLQASVSTERLEKYLGGDDLDTSAIRHDCNFDKAMQFSEASFTWEHDSEATVRDVNLD
IMAGQLVAVIGPVGSGKSSLISAMLGEMENVHGHITIKGTTAYVPQQSWIQNGTIKDNIL
FGTEFNEKRYQQVLEACALLPDLEMLPGGDLAEIGEKGINLSGGQKQRISLARATYQNLD
IYLLDDPLSAVDAHVGKHIFNKVLGPNGLLKGKTRLLVTHSMHFLPQVDEIVVLGNGTIV
EKGSYSALLAKKGEFAKNLKTFLRHTGPEEEATVHDGSEEEDDDYGLISSVEEIPEDAAS
ITMRRENSFRRTLSRSSRSNGRHLKSLRNSLKTRNVNSLKEDEELVKGQKLIKKEFIETG
KVKFSIYLEYLQAIGLFSIFFIILAFVMNSVAFIGSNLWLSAWTSDSKIFNSTDYPASQR
DMRVGVYGALGLAQGIFVFIAHFWSAFGFVHASNILHKQLLNNILRAPMRFFDTTPTGRI
VNRFAGDISTVDDTLPQSLRSWITCFLGIISTLVMICMATPVFTIIVIPLGIIYVSVQMF
YVSTSRQLRRLDSVTRSPIYSHFSETVSGLPVIRAFEHQQRFLKHNEVRIDTNQKCVFSW
ITSNRWLAIRLELVGNLTVFFSALMMVIYRDTLSGDTVGFVLSNALNITQTLNWLVRMTS
EIETNIVAVERITEYTKVENEAPWVTDKRPPPDWPSKGKIQFNNYQVRYRPELDLVLRGI
TCDIGSMEKIGVVGRTGAGKSSLTNCLFRILEAAGGQIIIDGVDIASIGLHDLREKLTII
PQDPILFSGSLRMNLDPFNNYSDEEIWKALELAHLKSFVASLQLGLSHEVTEAGGNLSIG
QRQLLCLGRALLRKSKILVLDEATAAVDLETDNLIQTTIQNEFAHCTVITIAHRLHTIMD
SDKVMVLDNGKIIECGSPEELLQIPGPFYFMAKEAGIENVNSTKF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0R4IC81	0.903	0.919	0.000	1518	0.468	0.476	A0A0R4IC81.pdb.gz	A0A0R4IC81_DANRE ABC-type glutathione-S-conjugate transporter OS=Danio rerio OX=7955 GN=abcc1 PE=3 SV=1
2	AFDB:A7KVC2	0.801	0.819	0.000	1510	0.323	0.330	A7KVC2.pdb.gz	AB4C_MAIZE ABC transporter C family MRP4 OS=Zea mays OX=4577 GN=MRP4 PE=2 SV=1
3	AFDB:B2RX12	0.865	0.877	0.000	1523	0.455	0.462	B2RX12.pdb.gz	MRP3_MOUSE ATP-binding cassette sub-family C member 3 OS=Mus musculus OX=10090 GN=Abcc3 PE=1 SV=2
4	AFDB:E7F118	0.890	0.912	0.000	1507	0.424	0.435	E7F118.pdb.gz	E7F118_DANRE ABC-type glutathione-S-conjugate transporter OS=Danio rerio OX=7955 GN=abcc6a PE=3 SV=1
5	AFDB:G5EFP3	0.881	0.866	0.000	1573	0.389	0.382	G5EFP3.pdb.gz	G5EFP3_CAEEL Multidrug resistance-associated protein 1 OS=Caenorhabditis elegans OX=6239 GN=mrp-4 PE=1 SV=1
6	AFDB:O15438	0.893	0.903	0.000	1527	0.458	0.463	O15438.pdb.gz	MRP3_HUMAN ATP-binding cassette sub-family C member 3 OS=Homo sapiens OX=9606 GN=ABCC3 PE=1 SV=3
7	AFDB:O15439	0.755	0.877	0.000	1325	0.306	0.357	O15439.pdb.gz	MRP4_HUMAN ATP-binding cassette sub-family C member 4 OS=Homo sapiens OX=9606 GN=ABCC4 PE=1 SV=3
8	AFDB:O88269	0.858	0.882	0.000	1502	0.350	0.360	O88269.pdb.gz	MRP6_RAT ATP-binding cassette sub-family C member 6 OS=Rattus norvegicus OX=10116 GN=Abcc6 PE=1 SV=1
9	AFDB:O95255	0.874	0.898	0.000	1503	0.368	0.378	O95255.pdb.gz	MRP6_HUMAN ATP-binding cassette sub-family C member 6 OS=Homo sapiens OX=9606 GN=ABCC6 PE=1 SV=2
10	AFDB:P14772	0.842	0.835	0.000	1559	0.343	0.340	P14772.pdb.gz	BPT1_YEAST Bile pigment transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BPT1 PE=1 SV=2
11	PDB:7mpeA	0.761	0.818	3.366E-102	1428	0.364	0.394	7mpeA.pdb.gz
12	PDB:6jb1B	0.708	0.794	2.745E-89	1366	0.295	0.334	6jb1B.pdb.gz	The Structural Basis for the Binding of Repaglinide to the Pancreatic KATPChannel.
13	PDB:7s5xE	0.694	0.753	1.650E-88	1412	0.291	0.319	7s5xE.pdb.gz	Molecular structure of an open human K ATP channel.
14	PDB:7vluA	0.660	0.861	8.535E-87	1159	0.272	0.363	7vluA.pdb.gz	Structural identification of vasodilator binding sites on the SUR2 subunit.
15	PDB:5ykfB	0.710	0.829	6.222E-84	1309	0.287	0.339	5ykfB.pdb.gz	Ligand binding and conformational changes of SUR1 subunit in pancreatic ATP-sensitive potassium channels.
16	PDB:6c3pE	0.671	0.754	1.200E-82	1359	0.290	0.330	6c3pE.pdb.gz	Molecular structure of human KATP in complex with ATP and ADP.
17	PDB:6c3oE	0.621	0.733	1.269E-77	1290	0.282	0.337	6c3oE.pdb.gz	Molecular structure of human KATP in complex with ATP and ADP
18	PDB:7mitE	0.726	0.776	1.733E-74	1438	0.299	0.321	7mitE.pdb.gz	Vascular K ATP channel structural dynamics reveal regulatory mechanism by Mg-nucleotides.
19	PDB:6msmA	0.641	0.818	3.876E-71	1181	0.221	0.289	6msmA.pdb.gz	Molecular structure of the ATP-bound, phosphorylated human CFTR.
20	PDB:5w81A	0.647	0.834	6.419E-66	1173	0.214	0.281	5w81A.pdb.gz	Conformational Changes of CFTR upon Phosphorylation and ATP Binding.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0A0MS99	1299	1215	0.421	0.536	A0A0A0MS99_HUMAN ABC-type glutathione-S-conjugate transporter OS=Homo sapiens OX=9606 GN=ABCC1 PE=1 SV=1
2	A0A0B4KGI0	768	1408	0.298	0.327	A0A0B4KGI0_DROME Uncharacterized protein, isoform E OS=Drosophila melanogaster OX=7227 GN=Mrp5 PE=4 SV=1
3	A0A0R4IAS5	706	1557	0.286	0.284	A0A0R4IAS5_DANRE ATP-binding cassette sub-family C member 9 isoform X7 OS=Danio rerio OX=7955 GN=si:dkey-183c2.3 PE=4 SV=2
4	A0A0R4IC81	1405	1518	0.473	0.482	A0A0R4IC81_DANRE ABC-type glutathione-S-conjugate transporter OS=Danio rerio OX=7955 GN=abcc1 PE=3 SV=1
5	A0A0S0WIA2	1286	1492	0.443	0.458	A0A0S0WIA2_DROME Multidrug-Resistance like protein 1, isoform R OS=Drosophila melanogaster OX=7227 GN=MRP PE=1 SV=1
6	A0A1S4NYG1	679	1582	0.294	0.287	A0A1S4NYG1_MESAU SUR1 OS=Mesocricetus auratus OX=10036 PE=1 SV=1
7	A0A1U7R319	680	1582	0.294	0.287	A0A1U7R319_MESAU ATP-binding cassette sub-family C member 8 isoform X2 OS=Mesocricetus auratus OX=10036 GN=Abcc8 PE=1 SV=1
8	A0A1U8QTJ9	778	1396	0.304	0.337	CICA_EMENI ABC-type transporter cicA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=cicA PE=1 SV=1
9	A7KVC2	792	1510	0.309	0.316	AB4C_MAIZE ABC transporter C family MRP4 OS=Zea mays OX=4577 GN=MRP4 PE=2 SV=1
10	B2RX12	1373	1523	0.459	0.466	MRP3_MOUSE ATP-binding cassette sub-family C member 3 OS=Mus musculus OX=10090 GN=Abcc3 PE=1 SV=2
11	E1B2R7	675	1426	0.241	0.262	E1B2R7_DANRE ATP-binding cassette sub-family C member 5 OS=Danio rerio OX=7955 GN=fj51h02 PE=2 SV=1
12	E7EYG0	681	1426	0.243	0.263	E7EYG0_DANRE ATP-binding cassette, sub-family C (CFTR/MRP), member 5 OS=Danio rerio OX=7955 GN=fj51h02 PE=4 SV=1
13	E7F118	1263	1507	0.438	0.449	E7F118_DANRE ABC-type glutathione-S-conjugate transporter OS=Danio rerio OX=7955 GN=abcc6a PE=3 SV=1
14	E9Q236	832	1325	0.315	0.367	MRP4_MOUSE ATP-binding cassette sub-family C member 4 OS=Mus musculus OX=10090 GN=Abcc4 PE=1 SV=1
15	F1LR52	833	1288	0.306	0.367	F1LR52_RAT ATP binding cassette subfamily C member 4 OS=Rattus norvegicus OX=10116 GN=Abcc4 PE=1 SV=4
16	F1M3J4	831	1325	0.315	0.368	MRP4_RAT ATP-binding cassette subfamily C member 4 OS=Rattus norvegicus OX=10116 GN=Abcc4 PE=1 SV=3
17	G5EE72	608	1427	0.260	0.281	MRP5_CAEEL Multidrug resistance-associated protein 5 OS=Caenorhabditis elegans OX=6239 GN=mrp-5 PE=2 SV=1
18	G5EFP3	1102	1573	0.404	0.397	G5EFP3_CAEEL Multidrug resistance-associated protein 1 OS=Caenorhabditis elegans OX=6239 GN=mrp-4 PE=1 SV=1
19	I3L4X2	1369	1440	0.463	0.497	I3L4X2_HUMAN ABC-type glutathione-S-conjugate transporter (Fragment) OS=Homo sapiens OX=9606 GN=ABCC1 PE=1 SV=1
20	O15438	1358	1527	0.466	0.472	MRP3_HUMAN ATP-binding cassette sub-family C member 3 OS=Homo sapiens OX=9606 GN=ABCC3 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12846 AAA_10	1.9e+02	12.4	AAA-like domain
2	PF13191 AAA_16	0.012	27.5	AAA ATPase domain
3	PF13304 AAA_21	2.2e+02	13.0	AAA domain, putative AbiEii toxin, Type IV TA system
4	PF13401 AAA_22	5.7	18.7	AAA domain
5	PF13479 AAA_24	1.2e+02	13.9	AAA domain
6	PF13555 AAA_29	0.18	22.9	P-loop containing region of AAA domain
7	PF13604 AAA_30	24	16.1	AAA domain
8	PF12775 AAA_7	3.8e+02	12.0	P-loop containing dynein motor region
9	PF08298 AAA_PrkA	1.1e+02	13.1	PrkA AAA domain
10	PF00664 ABC_membrane	4.1e-72	254.7	ABC transporter transmembrane region
11	PF00005 ABC_tran	1e-45	167.1	ABC transporter
12	PF00350 Dynamin_N	1.8	20.1	Dynamin family
13	PF18023 FKBP_N_2	2.7e+02	13.0	BDBT FKBP like N-terminal
14	PF00009 GTP_EFTU	5.7e+02	11.4	Elongation factor Tu GTP binding domain
15	PF00625 Guanylate_kin	2.1e+02	13.0	Guanylate kinase
16	PF03308 MeaB	1.4	19.4	Methylmalonyl Co-A mutase-associated GTPase MeaB
17	PF01926 MMR_HSR1	0.00091	30.7	50S ribosome-binding GTPase
18	PF19044 P-loop_TraG	21	15.2	TraG P-loop domain
19	PF00910 RNA_helicase	3.2e+02	13.1	RNA helicase
20	PF03193 RsgA_GTPase	0.032	25.6	RsgA GTPase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000359478

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000394485	0.956	Na(+)/H(+) exchange regulatory cofactor NHE-RF3
2	9606.ENSP00000237612	0.903	ATP-binding cassette sub-family G member 2
3	9606.ENSP00000256958	0.862	Solute carrier organic anion transporter family member 1B1
4	9606.ENSP00000261196	0.839	Solute carrier organic anion transporter family member 1B3
5	9606.ENSP00000441269	0.836	Solute carrier organic anion transporter family member
6	9606.ENSP00000296327	0.819	Organic solute transporter subunit alpha
7	9606.ENSP00000447149	0.807	Bile acid receptor
8	9606.ENSP00000216540	0.795	Sodium/bile acid cotransporter
9	9606.ENSP00000362549	0.791	UDP-glucuronosyltransferase 1-8
10	9606.ENSP00000304845	0.790	UDP-glucuronosyltransferase 1-1
11	9606.ENSP00000303174	0.779	UDP-glucuronosyltransferase 1-6
12	9606.ENSP00000384136	0.777	Radixin
13	9606.ENSP00000305974	0.757	Solute carrier organic anion transporter family member 1A2
14	9606.ENSP00000262613	0.744	Na(+)/H(+) exchange regulatory cofactor NHE-RF1
15	9606.ENSP00000337915	0.744	Cytochrome P450 3A4
16	9606.ENSP00000245539	0.732	Mitochondrial ribosomal protein S7
17	9606.ENSP00000336528	0.725	Nuclear receptor subfamily 1 group I member 2
18	9606.ENSP00000346768	0.725	UDP-glucuronosyltransferase 1-9
19	9606.ENSP00000289575	0.722	Solute carrier organic anion transporter family member 2B1
20	9606.ENSP00000335292	0.705	Organic solute transporter subunit beta

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005488	1.000	binding
GO:1901682	1.000	sulfur compound transmembrane transporter activity
GO:0140359	1.000	ABC-type transporter activity
GO:0046943	0.999	carboxylic acid transmembrane transporter activity
GO:0005515	0.994	protein binding
GO:0042910	0.994	xenobiotic transmembrane transporter activity
GO:0015318	0.976	inorganic molecular entity transmembrane transporter activity
GO:0008559	0.972	ABC-type xenobiotic transporter activity
GO:0005310	0.931	dicarboxylic acid transmembrane transporter activity
GO:0015103	0.926	inorganic anion transmembrane transporter activity
GO:0015431	0.494	ABC-type glutathione S-conjugate transporter activity
GO:0003824	0.483	catalytic activity
GO:0043167	0.445	ion binding
GO:0043168	0.377	anion binding
GO:0043225	0.370	ATPase-coupled inorganic anion transmembrane transporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0046942	0.989	carboxylic acid transport
GO:0050896	0.926	response to stimulus
GO:0009987	0.924	cellular process
GO:0015850	0.832	organic hydroxy compound transport
GO:0008152	0.826	metabolic process
GO:0055085	0.788	transmembrane transport
GO:0006869	0.787	lipid transport
GO:0042221	0.741	response to chemical
GO:0071704	0.722	organic substance metabolic process
GO:0015718	0.694	monocarboxylic acid transport
GO:0015721	0.653	bile acid and bile salt transport
GO:0042908	0.642	xenobiotic transport
GO:0044237	0.617	cellular metabolic process
GO:0065007	0.444	biological regulation
GO:0070887	0.438	cellular response to chemical stimulus
GO:0006807	0.334	nitrogen compound metabolic process
GO:1901360	0.316	organic cyclic compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0098590	0.988	plasma membrane region
GO:0045177	0.934	apical part of cell
GO:0043227	0.778	membrane-bounded organelle
GO:0005622	0.765	intracellular anatomical structure
GO:0043231	0.733	intracellular membrane-bounded organelle
GO:0005737	0.650	cytoplasm
GO:0016324	0.515	apical plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:7.-.-.-	1.000	Translocases.
EC:7.6.2.2	0.972	ABC-type xenobiotic transporter.
RHEA:19121	0.494	an S-substituted glutathione(in) + ATP + H2O = ADP + an S-substituted glutathione(out) + H(+) + phosphate
EC:7.6.2.3	0.494	ABC-type glutathione-S-conjugate transporter.

[back to server]