StarFunc result for job id Q92889

User Input

>input (916 residues)
MESGQPARRIAMAPLLEYERQLVLELLDTDGLVVCARGLGADRLLYHFLQLHCHPACLVL
VLNTQPAEEEYFINQLKIEGVEHLPRRVTNEITSNSRYEVYTQGGVIFATSRILVVDFLT
DRIPSDLITGILVYRAHRIIESCQEAFILRLFRQKNKRGFIKAFTDNAVAFDTGFCHVER
VMRNLFVRKLYLWPRFHVAVNSFLEQHKPEVVEIHVSMTPTMLAIQTAILDILNACLKEL
KCHNPSLEVEDLSLENAIGKPFDKTIRHYLDPLWHQLGAKTKSLVQDLKILRTLLQYLSQ
YDCVTFLNLLESLRATEKAFGQNSGWLFLDSSTSMFINARARVYHLPDAKMSKKEKISEK
MEIKEGEETKKELVLESNPKWEALTEVLKEIEAENKESEALGGPGQVLICASDDRTCSQL
RDYITLGAEAFLLRLYRKTFEKDSKAEEVWMKFRKEDSSKRIRKSHKRPKDPQNKERAST
KERTLKKKKRKLTLTQMVGKPEELEEEGDVEEGYRREISSSPESCPEEIKHEEFDVNLSS
DAAFGILKEPLTIIHPLLGCSDPYALTRVLHEVEPRYVVLYDAELTFVRQLEIYRASRPG
KPLRVYFLIYGGSTEEQRYLTALRKEKEAFEKLIREKASMVVPEEREGRDETNLDLVRGT
ASADVSTDTRKAGGQEQNGTQQSIVVDMREFRSELPSLIHRRGIDIEPVTLEVGDYILTP
EMCVERKSISDLIGSLNNGRLYSQCISMSRYYKRPVLLIEFDPSKPFSLTSRGALFQEIS
SNDISSKLTLLTLHFPRLRILWCPSPHATAELFEELKQSKPQPDAATALAITADSETLPE
SEKYNPGPQDFLLKMPGVNAKNCRSLMHHVKNIAELAALSQDELTSILGNAANAKQLYDF
IHTSFAEVVSKGKGKK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:D3ZT95	0.797	0.796	0.000	917	0.835	0.834	D3ZT95.pdb.gz	D3ZT95_RAT ERCC excision repair 4, endonuclease catalytic subunit OS=Rattus norvegicus OX=10116 GN=Ercc4 PE=3 SV=4
2	AFDB:Q92889	1.000	1.000	0.000	916	1.000	1.000	Q92889.pdb.gz	XPF_HUMAN DNA repair endonuclease XPF OS=Homo sapiens OX=9606 GN=ERCC4 PE=1 SV=3
3	PDB:6sxaF	0.690	0.839	1.133E-89	747	0.813	0.997	6sxaF.pdb.gz
4	PDB:6sxbF	0.623	0.796	1.406E-84	701	0.762	0.996	6sxbF.pdb.gz	Cryo-EM structures of the XPF-ERCC1 endonuclease reveal how DNA-junction engagement disrupts an auto-inhibited conformation.
5	AFDB:Q24087	0.730	0.697	3.546E-77	961	0.405	0.386	Q24087.pdb.gz	XPF_DROME DNA repair endonuclease XPF OS=Drosophila melanogaster OX=7227 GN=mei-9 PE=1 SV=2
6	AFDB:Q9LKI5	0.745	0.715	4.037E-74	956	0.369	0.354	Q9LKI5.pdb.gz	XPF_ARATH DNA repair endonuclease UVH1 OS=Arabidopsis thaliana OX=3702 GN=UVH1 PE=1 SV=2
7	AFDB:P36617	0.709	0.739	8.010E-72	877	0.334	0.349	P36617.pdb.gz	RAD16_SCHPO DNA repair protein rad16 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rad16 PE=1 SV=2
8	AFDB:Q54PN5	0.689	0.656	2.893E-69	964	0.320	0.304	Q54PN5.pdb.gz	XPF_DICDI DNA repair endonuclease XPF OS=Dictyostelium discoideum OX=44689 GN=ercc4 PE=3 SV=1
9	AFDB:P06777	0.664	0.561	3.120E-58	1100	0.309	0.257	P06777.pdb.gz	RAD1_YEAST DNA repair protein RAD1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RAD1 PE=1 SV=1
10	AFDB:G5EBZ1	0.664	0.651	2.141E-54	935	0.288	0.282	G5EBZ1.pdb.gz	G5EBZ1_CAEEL ERCC4 domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=xpf-1 PE=1 SV=1
11	AFDB:Q8TZH8	0.549	0.642	2.115E-30	764	0.177	0.212	Q8TZH8.pdb.gz	Q8TZH8_PYRFU ATP-dependent RNA helicase, putative OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) OX=186497 GN=PF2015 PE=1 SV=1
12	AFDB:Q9HE09	0.378	0.431	1.274E-14	783	0.081	0.095	Q9HE09.pdb.gz	MFH2_SCHPO Putative ATP-dependent DNA helicase fml2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=fml2 PE=3 SV=1
13	PDB:7bkpA	0.307	0.383	8.971E-11	689	0.091	0.120	7bkpA.pdb.gz	MDA5 disease variant M854K prevents ATP-dependent structural discrimination of viral and cellular RNA.
14	PDB:4a2wA	0.207	0.268	9.846E-10	678	0.066	0.088	4a2wA.pdb.gz
15	PDB:8dvsA	0.298	0.374	1.468E-9	682	0.093	0.125	8dvsA.pdb.gz	The RIG-I receptor adopts two different conformations for distinguishing host from viral RNA ligands.
16	PDB:7w0dA	0.286	0.184	1.622E-9	1544	0.067	0.040	7w0dA.pdb.gz	Structural insights into dsRNA processing by Drosophila Dicer-2-Loqs-PD.
17	PDB:7yymA	0.243	0.192	2.418E-9	1281	0.091	0.065	7yymA.pdb.gz	Structural and functional basis of mammalian microRNA biogenesis by Dicer.
18	PDB:7tnxA	0.287	0.375	1.319E-8	647	0.079	0.111	7tnxA.pdb.gz	The RIG-I receptor adopts two different conformations for distinguishing host from viral RNA ligands.
19	PDB:7v6bA	0.253	0.168	1.387E-8	1496	0.066	0.040	7v6bA.pdb.gz
20	PDB:6h61A	0.280	0.354	3.082E-8	660	0.082	0.114	6h61A.pdb.gz	Cryo-EM Structures of MDA5-dsRNA Filaments at Different Stages of ATP Hydrolysis.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I5ZWK5	0.0	1580	886	0.837	0.866	A0A8I5ZWK5_RAT ERCC excision repair 4, endonuclease catalytic subunit OS=Rattus norvegicus OX=10116 GN=Ercc4 PE=3 SV=1
2	D3ZT95	0.0	1657	917	0.869	0.868	D3ZT95_RAT ERCC excision repair 4, endonuclease catalytic subunit OS=Rattus norvegicus OX=10116 GN=Ercc4 PE=3 SV=4
3	Q24087	0.0	660	961	0.405	0.386	XPF_DROME DNA repair endonuclease XPF OS=Drosophila melanogaster OX=7227 GN=mei-9 PE=1 SV=2
4	Q92889	0.0	1889	916	1.000	1.000	XPF_HUMAN DNA repair endonuclease XPF OS=Homo sapiens OX=9606 GN=ERCC4 PE=1 SV=3
5	Q9QZD4	0.0	1639	917	0.861	0.860	XPF_MOUSE DNA repair endonuclease XPF OS=Mus musculus OX=10090 GN=Ercc4 PE=1 SV=3
6	P36617	4.88e-168	514	877	0.343	0.358	RAD16_SCHPO DNA repair protein rad16 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rad16 PE=1 SV=2
7	P06777	2.78e-125	407	1100	0.333	0.277	RAD1_YEAST DNA repair protein RAD1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RAD1 PE=1 SV=1
8	G5EBZ1	9.12e-94	318	935	0.289	0.283	G5EBZ1_CAEEL ERCC4 domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=xpf-1 PE=1 SV=1
9	Q9LKI5	8.11e-86	297	956	0.163	0.156	XPF_ARATH DNA repair endonuclease UVH1 OS=Arabidopsis thaliana OX=3702 GN=UVH1 PE=1 SV=2
10	Q54PN5	4.20e-80	281	964	0.156	0.148	XPF_DICDI DNA repair endonuclease XPF OS=Dictyostelium discoideum OX=44689 GN=ercc4 PE=3 SV=1
11	Q8TZH8	8.60e-19	94.0	764	0.097	0.116	Q8TZH8_PYRFU ATP-dependent RNA helicase, putative OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) OX=186497 GN=PF2015 PE=1 SV=1
12	Q8IYD8	1.74e-07	57.8	2048	0.067	0.030	FANCM_HUMAN Fanconi anemia group M protein OS=Homo sapiens OX=9606 GN=FANCM PE=1 SV=2
13	H0YJS3	2.60e-07	57.4	1979	0.067	0.031	H0YJS3_HUMAN FA complementation group M OS=Homo sapiens OX=9606 GN=FANCM PE=1 SV=2
14	H0YJ14	8.23e-07	55.8	1487	0.067	0.041	H0YJ14_HUMAN FA complementation group M (Fragment) OS=Homo sapiens OX=9606 GN=FANCM PE=1 SV=2
15	Q8T145	0.016	41.6	1789	0.081	0.041	Q8T145_DICDI DNA helicase OS=Dictyostelium discoideum OX=44689 GN=DDB_G0274841 PE=3 SV=2
16	Q9VDA0	0.98	35.8	1489	0.057	0.035	FANCM_DROME DEAD-box ATP-dependent DNA helicase Fancm OS=Drosophila melanogaster OX=7227 GN=Fancm PE=1 SV=2
17	P87231	1.1	35.4	608	0.027	0.041	MUS81_SCHPO Crossover junction endonuclease mus81 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mus81 PE=1 SV=2
18	P91153	2.5	34.3	445	0.025	0.052	P91153_CAEEL Crossover junction endonuclease MUS81 OS=Caenorhabditis elegans OX=6239 GN=mus-81 PE=1 SV=1
19	O14338	5.7	33.1	891	0.034	0.035	YB33_SCHPO Uncharacterized serine-rich protein C2F12.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC2F12.03c PE=1 SV=1
20	P70388	6.1	33.1	1312	0.016	0.011	RAD50_MOUSE DNA repair protein RAD50 OS=Mus musculus OX=10090 GN=Rad50 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02732 ERCC4	3.1e-21	87.6	ERCC4 domain
2	PF14520 HHH_5	5.6	18.9	Helix-hairpin-helix domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000310520

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000013807	0.999	DNA excision repair protein ERCC-1
2	9606.ENSP00000351284	0.997	DNA repair protein RAD52 homolog
3	9606.ENSP00000364270	0.997	DNA repair protein complementing XP-A cells
4	9606.ENSP00000347978	0.995	DNA repair protein complementing XP-G cells
5	9606.ENSP00000307853	0.994	Crossover junction endonuclease MUS81
6	9606.ENSP00000234420	0.993	DNA mismatch repair protein Msh6
7	9606.ENSP00000372088	0.993	DNA repair protein RAD51 homolog 1
8	9606.ENSP00000442336	0.993	DNA topoisomerase 3-alpha
9	9606.ENSP00000285398	0.992	TFIIH basal transcription factor complex helicase XPB subunit
10	9606.ENSP00000298139	0.992	Werner syndrome ATP-dependent helicase
11	9606.ENSP00000294008	0.991	Structure-specific endonuclease subunit SLX4
12	9606.ENSP00000233146	0.990	DNA mismatch repair protein Msh2
13	9606.ENSP00000285021	0.986	DNA repair protein complementing XP-C cells
14	9606.ENSP00000343741	0.986	Serine/threonine-protein kinase ATR
15	9606.ENSP00000347232	0.986	Bloom syndrome protein
16	9606.ENSP00000350708	0.984	UV excision repair protein RAD23 homolog B
17	9606.ENSP00000355506	0.984	Exonuclease 1
18	9606.ENSP00000484288	0.981	DNA ligase 4
19	9606.ENSP00000265038	0.978	DNA excision repair protein ERCC-8
20	9606.ENSP00000254719	0.976	Replication protein A 70 kDa DNA-binding subunit

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003697	1.000	single-stranded DNA binding
GO:0003684	1.000	damaged DNA binding
GO:0000014	1.000	single-stranded DNA endodeoxyribonuclease activity
GO:0042802	0.992	identical protein binding
GO:1990599	0.804	3' overhang single-stranded DNA endodeoxyribonuclease activity
GO:0001098	0.721	basal transcription machinery binding
GO:0008134	0.712	transcription factor binding
GO:0001091	0.685	RNA polymerase II general transcription initiation factor binding
GO:0044877	0.650	protein-containing complex binding
GO:0003682	0.598	chromatin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0050896	0.995	response to stimulus
GO:0044238	0.990	primary metabolic process
GO:0044237	0.990	cellular metabolic process
GO:0051716	0.989	cellular response to stimulus
GO:0006807	0.988	nitrogen compound metabolic process
GO:0043170	0.985	macromolecule metabolic process
GO:0006974	0.976	cellular response to DNA damage stimulus
GO:0006259	0.976	DNA metabolic process
GO:0006281	0.970	DNA repair
GO:0065007	0.827	biological regulation
GO:0050789	0.787	regulation of biological process
GO:0006302	0.658	double-strand break repair
GO:0009314	0.655	response to radiation
GO:0050794	0.654	regulation of cellular process
GO:0019222	0.634	regulation of metabolic process
GO:0031323	0.589	regulation of cellular metabolic process
GO:0006310	0.561	DNA recombination
GO:0071840	0.449	cellular component organization or biogenesis
GO:0060255	0.437	regulation of macromolecule metabolic process
GO:0051171	0.437	regulation of nitrogen compound metabolic process
GO:0080090	0.432	regulation of primary metabolic process
GO:0016043	0.430	cellular component organization
GO:0019219	0.389	regulation of nucleobase-containing compound metabolic process
GO:0048519	0.349	negative regulation of biological process
GO:0051052	0.349	regulation of DNA metabolic process
GO:0009411	0.325	response to UV

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0005694	0.998	chromosome
GO:0140513	0.998	nuclear protein-containing complex
GO:0000109	0.988	nucleotide-excision repair complex
GO:0098687	0.974	chromosomal region
GO:0000781	0.938	chromosome, telomeric region
GO:0000110	0.737	nucleotide-excision repair factor 1 complex
GO:0070522	0.492	ERCC4-ERCC1 complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.1.-.-	1.000	Acting on ester bonds.

[back to server]