StarFunc result for job id Q92896

User Input

>input (1179 residues)
MAACGRVRRMFRLSAALHLLLLFAAGAEKLPGQGVHSQGQGPGANFVSFVGQAGGGGPAG
QQLPQLPQSSQLQQQQQQQQQQQQPQPPQPPFPAGGPPARRGGAGAGGGWKLAEEESCRE
DVTRVCPKHTWSNNLAVLECLQDVREPENEISSDCNHLLWNYKLNLTTDPKFESVAREVC
KSTITEIKECADEPVGKGYMVSCLVDHRGNITEYQCHQYITKMTAIIFSDYRLICGFMDD
CKNDINILKCGSIRLGEKDAHSQGEVVSCLEKGLVKEAEEREPKIQVSELCKKAILRVAE
LSSDDFHLDRHLYFACRDDRERFCENTQAGEGRVYKCLFNHKFEESMSEKCREALTTRQK
LIAQDYKVSYSLAKSCKSDLKKYRCNVENLPRSREARLSYLLMCLESAVHRGRQVSSECQ
GEMLDYRRMLMEDFSLSPEIILSCRGEIEHHCSGLHRKGRTLHCLMKVVRGEKGNLGMNC
QQALQTLIQETDPGADYRIDRALNEACESVIQTACKHIRSGDPMILSCLMEHLYTEKMVE
DCEHRLLELQYFISRDWKLDPVLYRKCQGDASRLCHTHGWNETSEFMPQGAVFSCLYRHA
YRTEEQGRRLSRECRAEVQRILHQRAMDVKLDPALQDKCLIDLGKWCSEKTETGQELECL
QDHLDDLVVECRDIVGNLTELESEDIQIEALLMRACEPIIQNFCHDVADNQIDSGDLMEC
LIQNKHQKDMNEKCAIGVTHFQLVQMKDFRFSYKFKMACKEDVLKLCPNIKKKVDVVICL
STTVRNDTLQEAKEHRVSLKCRRQLRVEELEMTEDIRLEPDLYEACKSDIKNFCSAVQYG
NAQIIECLKENKKQLSTRCHQKVFKLQETEMMDPELDYTLMRVCKQMIKRFCPEADSKTM
LQCLKQNKNSELMDPKCKQMITKRQITQNTDYRLNPMLRKACKADIPKFCHGILTKAKDD
SELEGQVISCLKLRYADQRLSSDCEDQIRIIIQESALDYRLDPQLQLHCSDEISSLCAEE
AAAQEQTGQVEECLKVNLLKIKTELCKKEVLNMLKESKADIFVDPVLHTACALDIKHHCA
AITPGRGRQMSCLMEALEDKRVRLQPECKKRLNDRIEMWSYAAKVAPADGFSDLAMQVMT
SPSKNYILSVISGSICILFLIGLMCGRITKRVTRELKDR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q92896	1.000	1.000	0.000	1179	1.000	1.000	Q92896.pdb.gz	GSLG1_HUMAN Golgi apparatus protein 1 OS=Homo sapiens OX=9606 GN=GLG1 PE=1 SV=2
2	AFDB:M9PIG4	0.652	0.687	6.077E-66	1107	0.308	0.328	M9PIG4.pdb.gz	M9PIG4_DROME Golgi complex-localized glycoprotein 1, isoform B OS=Drosophila melanogaster OX=7227 GN=Glg1 PE=1 SV=1
3	PDB:1qgkA	0.116	0.141	1.089E-4	876	0.093	0.126	1qgkA.pdb.gz
4	PDB:6tc0C	0.103	0.112	1.227E-4	994	0.115	0.136	6tc0C.pdb.gz
5	PDB:4a0cA	0.099	0.100	1.496E-4	1155	0.134	0.137	4a0cA.pdb.gz	The Molecular Basis of Crl4(Ddb2/Csa) Ubiquitin Ligase Architecture, Targeting, and Activation
6	AFDB:Q5T2S8	0.101	0.110	1.769E-4	1044	0.091	0.102	Q5T2S8.pdb.gz	ODAD2_HUMAN Outer dynein arm-docking complex subunit 2 OS=Homo sapiens OX=9606 GN=ODAD2 PE=1 SV=1
7	PDB:2z6gA	0.112	0.163	3.727E-4	550	0.061	0.131	2z6gA.pdb.gz
8	AFDB:Q9LS88	0.098	0.123	4.406E-4	842	0.094	0.132	Q9LS88.pdb.gz	PP250_ARATH Pentatricopeptide repeat-containing protein At3g23020 OS=Arabidopsis thaliana OX=3702 GN=At3g23020 PE=2 SV=1
9	PDB:3wyfC	0.101	0.109	5.120E-4	1040	0.109	0.123	3wyfC.pdb.gz	Structural insights into how yrb2p accelerates the assembly of the xpo1p nuclear export complex
10	PDB:6xu2A	0.114	0.119	5.543E-4	1091	0.090	0.097	6xu2A.pdb.gz	X-ray Structure of the Human Karyopherin RanBP5, an Essential Factor for Influenza Polymerase Nuclear Trafficking.
11	PDB:3nd2A	0.104	0.127	5.768E-4	861	0.088	0.121	3nd2A.pdb.gz
12	PDB:5yu7A	0.095	0.097	7.923E-4	1118	0.139	0.147	5yu7A.pdb.gz
13	PDB:7unkA	0.101	0.109	8.577E-4	1047	0.111	0.125	7unkA.pdb.gz
14	AFDB:A2AGT5	0.088	0.065	9.366E-4	2032	0.154	0.089	A2AGT5.pdb.gz	CKAP5_MOUSE Cytoskeleton-associated protein 5 OS=Mus musculus OX=10090 GN=Ckap5 PE=1 SV=1
15	PDB:7wo9A	0.107	0.090	1.088E-3	1581	0.110	0.082	7wo9A.pdb.gz
16	AFDB:B0BF33	0.090	0.116	1.767E-3	815	0.072	0.104	B0BF33.pdb.gz	PKP2_DANRE Plakophilin-2 OS=Danio rerio OX=7955 GN=pkp2 PE=2 SV=1
17	AFDB:Q06680	0.099	0.108	2.332E-2	1035	0.098	0.112	Q06680.pdb.gz	CND3_YEAST Condensin complex subunit 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YCG1 PE=1 SV=2
18	AFDB:A0A1D8PTY4	0.098	0.098	2.524E-2	1195	0.070	0.069	A0A1D8PTY4.pdb.gz	A0A1D8PTY4_CANAL Elf1p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ELF1 PE=3 SV=1
19	AFDB:G5EB71	0.107	0.146	2.959E-2	778	0.055	0.084	G5EB71.pdb.gz	G5EB71_EMENI Rad26-like helical repeats domain-containing protein OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_05165 PE=4 SV=1
20	AFDB:Q8NDZ2	0.096	0.116	3.203E-2	872	0.066	0.089	Q8NDZ2.pdb.gz	SIMC1_HUMAN SUMO-interacting motif-containing protein 1 OS=Homo sapiens OX=9606 GN=SIMC1 PE=1 SV=3

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	M9PIG4	0.0	649	1107	0.309	0.329	M9PIG4_DROME Golgi complex-localized glycoprotein 1, isoform B OS=Drosophila melanogaster OX=7227 GN=Glg1 PE=1 SV=1
2	Q61543	0.0	2195	1175	0.940	0.943	GSLG1_MOUSE Golgi apparatus protein 1 OS=Mus musculus OX=10090 GN=Glg1 PE=1 SV=1
3	Q62638	0.0	2217	1171	0.952	0.958	GSLG1_RAT Golgi apparatus protein 1 OS=Rattus norvegicus OX=10116 GN=Glg1 PE=1 SV=1
4	Q92896	0.0	2435	1179	1.000	1.000	GSLG1_HUMAN Golgi apparatus protein 1 OS=Homo sapiens OX=9606 GN=GLG1 PE=1 SV=2
5	Q9VP27	0.0	654	1103	0.309	0.330	Q9VP27_DROME Golgi complex-localized glycoprotein 1, isoform A OS=Drosophila melanogaster OX=7227 GN=Glg1 PE=1 SV=2
6	O88778	1.4	35.8	3938	0.021	0.006	BSN_RAT Protein bassoon OS=Rattus norvegicus OX=10116 GN=Bsn PE=1 SV=3
7	O14976	4.3	33.9	1311	0.030	0.027	GAK_HUMAN Cyclin-G-associated kinase OS=Homo sapiens OX=9606 GN=GAK PE=1 SV=2
8	Q70JA7	6.5	33.5	882	0.026	0.035	CHSS3_HUMAN Chondroitin sulfate synthase 3 OS=Homo sapiens OX=9606 GN=CHSY3 PE=2 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00839 Cys_rich_FGFR	1.2e-200	661.2	Cysteine rich repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000205061

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000331736	0.998	E-selectin
2	9606.ENSP00000263686	0.815	P-selectin
3	9606.ENSP00000264498	0.732	Fibroblast growth factor 2
4	9606.ENSP00000228463	0.662	P-selectin glycoprotein ligand 1
5	9606.ENSP00000398597	0.654	Exosome complex component MTR3
6	9606.ENSP00000357005	0.610	Junctional adhesion molecule A
7	9606.ENSP00000356630	0.607	Headcase protein homolog
8	9606.ENSP00000377257	0.600	CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 2
9	9606.ENSP00000398632	0.580	CD44 antigen
10	9606.ENSP00000407323	0.544	Probable rRNA-processing protein EBP2
11	9606.ENSP00000236147	0.530	L-selectin
12	9606.ENSP00000464275	0.502	Protein Njmu-R1
13	9606.ENSP00000294258	0.501	Zinc finger protein-like 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005102	1.000	signaling receptor binding
GO:0017134	0.382	fibroblast growth factor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.984	cellular process
GO:0050794	0.981	regulation of cellular process
GO:0008152	0.972	metabolic process
GO:0071704	0.954	organic substance metabolic process
GO:0006807	0.952	nitrogen compound metabolic process
GO:0009966	0.952	regulation of signal transduction
GO:0032501	0.951	multicellular organismal process
GO:0007165	0.950	signal transduction
GO:0032502	0.945	developmental process
GO:0071495	0.945	cellular response to endogenous stimulus
GO:0044238	0.944	primary metabolic process
GO:0048856	0.941	anatomical structure development
GO:0048523	0.941	negative regulation of cellular process
GO:1901564	0.938	organonitrogen compound metabolic process
GO:0043170	0.936	macromolecule metabolic process
GO:0019538	0.933	protein metabolic process
GO:0051246	0.926	regulation of protein metabolic process
GO:0051239	0.919	regulation of multicellular organismal process
GO:0045861	0.903	negative regulation of proteolysis
GO:0007275	0.895	multicellular organism development
GO:0090287	0.893	regulation of cellular response to growth factor stimulus
GO:0090092	0.880	regulation of transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0071363	0.878	cellular response to growth factor stimulus
GO:0007178	0.858	transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0009968	0.838	negative regulation of signal transduction
GO:0050793	0.835	regulation of developmental process
GO:2000026	0.829	regulation of multicellular organismal development
GO:0010629	0.827	negative regulation of gene expression
GO:0009887	0.819	animal organ morphogenesis
GO:0071559	0.814	response to transforming growth factor beta
GO:0060348	0.810	bone development
GO:0032330	0.809	regulation of chondrocyte differentiation
GO:1903317	0.792	regulation of protein maturation
GO:0051604	0.788	protein maturation
GO:0017015	0.788	regulation of transforming growth factor beta receptor signaling pathway
GO:0090101	0.788	negative regulation of transmembrane receptor protein serine/threonine kinase signaling pathway
GO:1903318	0.765	negative regulation of protein maturation
GO:0006508	0.761	proteolysis
GO:0048705	0.760	skeletal system morphogenesis
GO:0071560	0.735	cellular response to transforming growth factor beta stimulus
GO:0060349	0.732	bone morphogenesis
GO:0030512	0.728	negative regulation of transforming growth factor beta receptor signaling pathway
GO:0007179	0.689	transforming growth factor beta receptor signaling pathway
GO:0070613	0.637	regulation of protein processing
GO:0016485	0.422	protein processing
GO:0010955	0.414	negative regulation of protein processing

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005794	1.000	Golgi apparatus
GO:0098588	0.997	bounding membrane of organelle
GO:0071944	0.996	cell periphery
GO:0005886	0.994	plasma membrane
GO:0005576	0.986	extracellular region
GO:0000139	0.979	Golgi membrane
GO:0070062	0.966	extracellular exosome
GO:0031984	0.451	organelle subcompartment
GO:0098791	0.435	Golgi apparatus subcompartment
GO:0031012	0.358	extracellular matrix
GO:0070013	0.342	intracellular organelle lumen
GO:0031985	0.318	Golgi cisterna
GO:0097708	0.303	intracellular vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]