StarFunc result for job id Q92900

User Input

>input (1129 residues)
MSVEAYGPSSQTLTFLDTEEAELLGADTQGSEFEFTDFTLPSQTQTPPGGPGGPGGGGAG
GPGGAGAGAAAGQLDAQVGPEGILQNGAVDDSVAKTSQLLAELNFEEDEEDTYYTKDLPI
HACSYCGIHDPACVVYCNTSKKWFCNGRGNTSGSHIVNHLVRAKCKEVTLHKDGPLGETV
LECYNCGCRNVFLLGFIPAKADSVVVLLCRQPCASQSSLKDINWDSSQWQPLIQDRCFLS
WLVKIPSEQEQLRARQITAQQINKLEELWKENPSATLEDLEKPGVDEEPQHVLLRYEDAY
QYQNIFGPLVKLEADYDKKLKESQTQDNITVRWDLGLNKKRIAYFTLPKTDSGNEDLVII
WLRDMRLMQGDEICLRYKGDLAPLWKGIGHVIKVPDNYGDEIAIELRSSVGAPVEVTHNF
QVDFVWKSTSFDRMQSALKTFAVDETSVSGYIYHKLLGHEVEDVIIKCQLPKRFTAQGLP
DLNHSQVYAVKTVLQRPLSLIQGPPGTGKTVTSATIVYHLARQGNGPVLVCAPSNIAVDQ
LTEKIHQTGLKVVRLCAKSREAIDSPVSFLALHNQIRNMDSMPELQKLQQLKDETGELSS
ADEKRYRALKRTAERELLMNADVICCTCVGAGDPRLAKMQFRSILIDESTQATEPECMVP
VVLGAKQLILVGDHCQLGPVVMCKKAAKAGLSQSLFERLVVLGIRPIRLQVQYRMHPALS
AFPSNIFYEGSLQNGVTAADRVKKGFDFQWPQPDKPMFFYVTQGQEEIASSGTSYLNRTE
AANVEKITTKLLKAGAKPDQIGIITPYEGQRSYLVQYMQFSGSLHTKLYQEVEIASVDAF
QGREKDFIILSCVRANEHQGIGFLNDPRRLNVALTRARYGVIIVGNPKALSKQPLWNHLL
NYYKEQKVLVEGPLNNLRESLMQFSKPRKLVNTINPGARFMTTAMYDAREAIIPGSVYDR
SSQGRPSSMYFQTHDQIGMISAGPSHVAAMNIPIPFNLVMPPMPPPGYFGQANGPAAGRG
TPKGKTGRGGRQKNRFGLPGPSQTNLPNSQASQDVASQPFSQGALTQGYISMSQPSQMSQ
PGLSQPELSQDSYLGDEFKSQIDVALSQDSTYQGERAYQHGGVTGLSQY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024R7L8	0.741	0.741	0.000	1129	1.000	1.000	A0A024R7L8.pdb.gz
2	AFDB:O76512	0.703	0.741	0.000	1069	0.453	0.479	O76512.pdb.gz	RENT1_CAEEL Regulator of nonsense transcripts 1 OS=Caenorhabditis elegans OX=6239 GN=smg-2 PE=1 SV=1
3	AFDB:P30771	0.696	0.807	0.000	971	0.424	0.493	P30771.pdb.gz	RENT1_YEAST ATP-dependent helicase NAM7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NAM7 PE=1 SV=1
4	AFDB:Q09820	0.711	0.864	0.000	925	0.440	0.537	Q09820.pdb.gz	RENT1_SCHPO ATP-dependent helicase upf1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=upf1 PE=3 SV=2
5	AFDB:Q9VYS3	0.714	0.683	0.000	1180	0.646	0.618	Q9VYS3.pdb.gz	RENT1_DROME Regulator of nonsense transcripts 1 homolog OS=Drosophila melanogaster OX=7227 GN=Upf1 PE=1 SV=2
6	AFDB:Q582F1	0.659	0.877	1.482E-89	842	0.313	0.419	Q582F1.pdb.gz	Q582F1_TRYB2 Regulator of nonsense transcripts 1, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.3C6.50 PE=3 SV=1
7	AFDB:B6SFA4	0.415	0.561	7.919E-40	818	0.169	0.233	B6SFA4.pdb.gz	MAA3_ARATH Probable helicase MAGATAMA 3 OS=Arabidopsis thaliana OX=3702 GN=MAA3 PE=2 SV=1
8	PDB:5eanA	0.422	0.452	6.927E-37	1051	0.141	0.151	5eanA.pdb.gz	Dna2 nuclease-helicase structure, mechanism and regulation by Rpa.
9	AFDB:Q6DFV5	0.396	0.241	8.119E-32	1964	0.187	0.107	Q6DFV5.pdb.gz	HELZ_MOUSE Probable helicase with zinc finger domain OS=Mus musculus OX=10090 GN=Helz PE=1 SV=2
10	PDB:4pj3A	0.364	0.312	4.371E-29	1335	0.125	0.106	4pj3A.pdb.gz	The RNA helicase Aquarius exhibits structural adaptations mediating its recruitment to spliceosomes.
11	PDB:3jb9X	0.360	0.342	2.898E-18	1195	0.117	0.110	3jb9X.pdb.gz	Structure of a yeast spliceosome at 3.6-angstrom resolution
12	PDB:5ld2D	0.230	0.398	2.527E-10	605	0.078	0.145	5ld2D.pdb.gz	Mechanism for nuclease regulation in RecBCD.
13	PDB:3k70D	0.176	0.332	1.084E-9	547	0.064	0.132	3k70D.pdb.gz	DNA binding to RecD: role of the 1B domain in SF1B helicase activity.
14	PDB:2is6A	0.202	0.333	7.557E-9	654	0.074	0.128	2is6A.pdb.gz	UvrD helicase unwinds DNA one base pair at a time by a two-part power stroke.
15	PDB:1uaaA	0.199	0.338	8.418E-9	636	0.066	0.116	1uaaA.pdb.gz	Major domain swiveling revealed by the crystal structures of complexes of E. coli Rep helicase bound to single-stranded DNA and ADP.
16	PDB:2is4B	0.210	0.360	1.296E-8	632	0.064	0.114	2is4B.pdb.gz	UvrD helicase unwinds DNA one base pair at a time by a two-part power stroke.
17	PDB:7zelA	0.184	0.243	1.697E-8	827	0.039	0.053	7zelA.pdb.gz	Mechanistic understanding of human SLFN11.
18	AFDB:F4KBP5	0.204	0.114	5.101E-8	2223	0.122	0.062	F4KBP5.pdb.gz	CHR4_ARATH Protein CHROMATIN REMODELING 4 OS=Arabidopsis thaliana OX=3702 GN=CHR4 PE=2 SV=1
19	PDB:6g0lM	0.214	0.273	4.555E-7	855	0.073	0.096	6g0lM.pdb.gz	Structure of the chromatin remodelling enzyme Chd1 bound to a ubiquitinylated nucleosome.
20	AFDB:Q6EVK6	0.217	0.121	1.525E-6	2193	0.085	0.044	Q6EVK6.pdb.gz	BRM_ARATH ATP-dependent helicase BRM OS=Arabidopsis thaliana OX=3702 GN=BRM PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A024R7L5	0.0	2315	1118	0.990	1.000	A0A024R7L5_HUMAN UPF1 OS=Homo sapiens OX=9606 GN=UPF1 PE=2 SV=1
2	F1RCY6	0.0	2110	1100	0.923	0.947	RENT1_DANRE Regulator of nonsense transcripts 1 OS=Danio rerio OX=7955 GN=upf1 PE=2 SV=1
3	O76512	0.0	1011	1069	0.455	0.481	RENT1_CAEEL Regulator of nonsense transcripts 1 OS=Caenorhabditis elegans OX=6239 GN=smg-2 PE=1 SV=1
4	P30771	0.0	965	971	0.420	0.488	RENT1_YEAST ATP-dependent helicase NAM7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NAM7 PE=1 SV=1
5	Q09820	0.0	1051	925	0.440	0.537	RENT1_SCHPO ATP-dependent helicase upf1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=upf1 PE=3 SV=2
6	Q582F1	0.0	652	842	0.315	0.423	Q582F1_TRYB2 Regulator of nonsense transcripts 1, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.3C6.50 PE=3 SV=1
7	Q92900	0.0	2347	1129	1.000	1.000	RENT1_HUMAN Regulator of nonsense transcripts 1 OS=Homo sapiens OX=9606 GN=UPF1 PE=1 SV=2
8	Q9EPU0	0.0	2313	1124	0.985	0.989	RENT1_MOUSE Regulator of nonsense transcripts 1 OS=Mus musculus OX=10090 GN=Upf1 PE=1 SV=2
9	Q9FJR0	0.0	1268	1254	0.570	0.514	RENT1_ARATH Regulator of nonsense transcripts 1 homolog OS=Arabidopsis thaliana OX=3702 GN=UPF1 PE=1 SV=2
10	Q9VYS3	0.0	1397	1180	0.608	0.581	RENT1_DROME Regulator of nonsense transcripts 1 homolog OS=Drosophila melanogaster OX=7227 GN=Upf1 PE=1 SV=2
11	P32644	8.43e-65	241	1121	0.150	0.151	ECM32_YEAST Putative ATP-dependent RNA helicase ECM32 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ECM32 PE=1 SV=1
12	O94247	2.16e-61	224	660	0.159	0.271	HCS1_SCHPO DNA polymerase alpha-associated DNA helicase A OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=hcs1 PE=3 SV=1
13	Q92355	3.91e-57	219	1687	0.159	0.107	SEN1_SCHPO Helicase sen1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sen1 PE=1 SV=1
14	O81047	6.45e-55	205	639	0.136	0.241	O81047_ARATH DNA-binding protein OS=Arabidopsis thaliana OX=3702 GN=At2g03270 PE=1 SV=2
15	Q00416	7.15e-53	206	2231	0.166	0.084	SEN1_YEAST Helicase SEN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SEN1 PE=1 SV=2
16	O94387	1.38e-52	205	1944	0.148	0.086	YGSA_SCHPO Uncharacterized ATP-dependent helicase C29A10.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC29A10.10c PE=3 SV=1
17	F4K1G7	2.11e-51	199	961	0.129	0.152	F4K1G7_ARATH P-loop containing nucleoside triphosphate hydrolases superfamily protein OS=Arabidopsis thaliana OX=3702 GN=MEE13.8 PE=1 SV=1
18	Q8GYD9	2.07e-50	196	1002	0.141	0.159	SDE3_ARATH Probable RNA helicase SDE3 OS=Arabidopsis thaliana OX=3702 GN=SDE3 PE=1 SV=1
19	P40694	6.49e-50	194	993	0.155	0.176	SMBP2_MOUSE DNA-binding protein SMUBP-2 OS=Mus musculus OX=10090 GN=Ighmbp2 PE=1 SV=1
20	B6SFA4	1.05e-49	192	818	0.130	0.180	MAA3_ARATH Probable helicase MAGATAMA 3 OS=Arabidopsis thaliana OX=3702 GN=MAA3 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12846 AAA_10	4.2e+02	11.2	AAA-like domain
2	PF13086 AAA_11	8.4e-45	165.2	AAA domain
3	PF13087 AAA_12	1.4e-56	202.8	AAA domain
4	PF13245 AAA_19	1.5e-07	43.2	AAA domain
5	PF13604 AAA_30	1e-09	49.9	AAA domain
6	PF06745 ATPase	3	18.7	KaiC
7	PF00270 DEAD	4e+02	12.2	DEAD/DEAH box helicase
8	PF09848 DUF2075	0.27	22.1	Schlafen group 3, DNA/RNA helicase domain
9	PF05127 Helicase_RecD	1.4	20.3	Helicase
10	PF04851 ResIII	0.052	25.0	Type III restriction enzyme, res subunit
11	PF00448 SRP54	19	16.4	SRP54-type protein, GTPase domain
12	PF18141 UPF1_1B_dom	8.1e-26	101.2	RNA helicase UPF1, 1B domain
13	PF09416 UPF1_Zn_bind	4.8e-74	258.8	RNA helicase (UPF2 interacting domain)
14	PF00580 UvrD-helicase	70	14.4	UvrD/REP helicase N-terminal domain
15	PF13538 UvrD_C_2	99	14.2	UvrD-like helicase C-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000470142

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000263073	0.999	Telomerase-binding protein EST1A
2	9606.ENSP00000269349	0.999	Eukaryotic initiation factor 4A-III
3	9606.ENSP00000276201	0.999	Regulator of nonsense transcripts 3B
4	9606.ENSP00000341247	0.999	Eukaryotic peptide chain release factor GTP-binding subunit ERF3B
5	9606.ENSP00000348708	0.999	Regulator of nonsense transcripts 2
6	9606.ENSP00000355261	0.999	Protein SMG5
7	9606.ENSP00000364289	0.999	Nuclear cap-binding protein subunit 1
8	9606.ENSP00000364448	0.999	Regulator of nonsense transcripts 3A
9	9606.ENSP00000398131	0.999	Eukaryotic peptide chain release factor GTP-binding subunit ERF3A
10	9606.ENSP00000402515	0.999	Serine/threonine-protein kinase SMG1
11	9606.ENSP00000425133	0.999	Protein SMG7
12	9606.ENSP00000463058	0.999	RNA-binding protein 8A
13	9606.ENSP00000264645	0.998	Protein CASC3
14	9606.ENSP00000360922	0.997	Double-stranded RNA-binding protein Staufen homolog 1
15	9606.ENSP00000313007	0.996	Polyadenylate-binding protein 1
16	9606.ENSP00000360525	0.995	Protein mago nashi homolog
17	9606.ENSP00000356811	0.994	HBS1-like protein
18	9606.ENSP00000373715	0.994	m7GpppN-mRNA hydrolase
19	9606.ENSP00000353741	0.992	Eukaryotic peptide chain release factor subunit 1
20	9606.ENSP00000417686	0.991	Histone RNA hairpin-binding protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0003676	0.996	nucleic acid binding
GO:0003824	0.991	catalytic activity
GO:0003723	0.990	RNA binding
GO:0140640	0.979	catalytic activity, acting on a nucleic acid
GO:0004386	0.953	helicase activity
GO:0140097	0.927	catalytic activity, acting on DNA
GO:0016787	0.874	hydrolase activity
GO:0140098	0.782	catalytic activity, acting on RNA
GO:0008186	0.732	ATP-dependent activity, acting on RNA
GO:0003724	0.642	RNA helicase activity
GO:0003677	0.451	DNA binding
GO:0008094	0.420	ATP-dependent activity, acting on DNA
GO:0003678	0.398	DNA helicase activity
GO:0016817	0.337	hydrolase activity, acting on acid anhydrides
GO:0016462	0.328	pyrophosphatase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044238	0.997	primary metabolic process
GO:0043170	0.996	macromolecule metabolic process
GO:0060255	0.996	regulation of macromolecule metabolic process
GO:0034641	0.995	cellular nitrogen compound metabolic process
GO:0010468	0.994	regulation of gene expression
GO:0048519	0.988	negative regulation of biological process
GO:0016070	0.988	RNA metabolic process
GO:0044260	0.977	cellular macromolecule metabolic process
GO:0050794	0.971	regulation of cellular process
GO:0010605	0.969	negative regulation of macromolecule metabolic process
GO:0051171	0.936	regulation of nitrogen compound metabolic process
GO:0031323	0.936	regulation of cellular metabolic process
GO:0000956	0.936	nuclear-transcribed mRNA catabolic process
GO:0080090	0.932	regulation of primary metabolic process
GO:0000184	0.906	nuclear-transcribed mRNA catabolic process, nonsense-mediated decay
GO:0010608	0.638	post-transcriptional regulation of gene expression
GO:0019219	0.623	regulation of nucleobase-containing compound metabolic process
GO:0051252	0.594	regulation of RNA metabolic process
GO:0050896	0.582	response to stimulus
GO:1903311	0.490	regulation of mRNA metabolic process
GO:0010467	0.432	gene expression
GO:0048522	0.425	positive regulation of cellular process
GO:0009894	0.403	regulation of catabolic process
GO:0031329	0.363	regulation of cellular catabolic process
GO:0010556	0.334	regulation of macromolecule biosynthetic process
GO:0071840	0.331	cellular component organization or biogenesis
GO:0010604	0.327	positive regulation of macromolecule metabolic process
GO:0031326	0.326	regulation of cellular biosynthetic process
GO:0061013	0.324	regulation of mRNA catabolic process
GO:0048523	0.320	negative regulation of cellular process
GO:0051716	0.315	cellular response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005654	0.999	nucleoplasm
GO:0032991	0.958	protein-containing complex
GO:0043232	0.805	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.-.-.-	0.874	Hydrolases.
EC:3.6.4.13	0.642	RNA helicase.
EC:3.6.-.-	0.337	Acting on acid anhydrides.
EC:3.6.1.-	0.328	In phosphorus-containing anhydrides.

[back to server]