StarFunc result for job id Q92905

User Input

>input (334 residues)
MAASGSGMAQKTWELANNMQEAQSIDEIYKYDKKQQQEILAAKPWTKDHHYFKYCKISAL
ALLKMVMHARSGGNLEVMGLMLGKVDGETMIIMDSFALPVEGTETRVNAQAAAYEYMAAY
IENAKQVGRLENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGK
VNLGAFRTYPKGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVSYFKSSLDRKLLEL
LWNKYWVNTLSSSSLLTNADYTTGQVFDLSEKLEQSEAQLGRGSFMLGLETHDRKSEDKL
AKATRDSCKTTIEAIHGLMSQVIKDKLFNQINIS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:F2Z540	0.893	0.868	2.305E-62	344	1.000	0.971	F2Z540.pdb.gz
2	AFDB:Q9XZ58	0.937	0.956	1.138E-58	327	0.734	0.749	Q9XZ58.pdb.gz	CSN5_DROME COP9 signalosome complex subunit 5 OS=Drosophila melanogaster OX=7227 GN=CSN5 PE=1 SV=1
3	AFDB:Q54PF3	0.909	0.915	9.968E-54	332	0.656	0.660	Q54PF3.pdb.gz	CSN5_DICDI COP9 signalosome complex subunit 5 OS=Dictyostelium discoideum OX=44689 GN=csn5 PE=1 SV=1
4	AFDB:Q8H936	0.901	0.837	1.626E-53	360	0.686	0.636	Q8H936.pdb.gz	CSN5_ORYSJ COP9 signalosome complex subunit 5 OS=Oryza sativa subsp. japonica OX=39947 GN=CSN5 PE=1 SV=1
5	AFDB:Q8LAZ7	0.899	0.842	2.401E-52	357	0.668	0.625	Q8LAZ7.pdb.gz	CSN5A_ARATH COP9 signalosome complex subunit 5a OS=Arabidopsis thaliana OX=3702 GN=CSN5A PE=1 SV=2
6	AFDB:Q9FVU9	0.888	0.830	2.172E-51	358	0.680	0.634	Q9FVU9.pdb.gz	CSN5B_ARATH COP9 signalosome complex subunit 5b OS=Arabidopsis thaliana OX=3702 GN=CSN5B PE=1 SV=1
7	PDB:6r7fE	0.720	0.765	7.639E-50	311	0.931	1.000	6r7fE.pdb.gz
8	AFDB:P91001	0.872	0.793	2.235E-47	368	0.548	0.497	P91001.pdb.gz	CSN5_CAEEL COP9 signalosome complex subunit 5 OS=Caenorhabditis elegans OX=6239 GN=csn-5 PE=1 SV=1
9	AFDB:Q5BBF1	0.900	0.897	3.300E-46	335	0.527	0.525	Q5BBF1.pdb.gz	CSN5_EMENI COP9 signalosome complex subunit 5 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=rri1 PE=1 SV=2
10	AFDB:O94454	0.626	0.696	1.949E-34	299	0.374	0.418	O94454.pdb.gz	CSN5_SCHPO COP9 signalosome complex subunit 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=csn5 PE=1 SV=1
11	AFDB:Q86IJ1	0.489	0.531	3.258E-22	306	0.275	0.301	Q86IJ1.pdb.gz	PSDE_DICDI 26S proteasome non-ATPase regulatory subunit 14 OS=Dictyostelium discoideum OX=44689 GN=psmD14 PE=3 SV=1
12	PDB:5mpbV	0.473	0.540	1.060E-18	289	0.243	0.280	5mpbV.pdb.gz	Structural insights into the functional cycle of the ATPase module of the 26S proteasome.
13	PDB:5l4kV	0.485	0.547	1.954E-18	293	0.257	0.294	5l4kV.pdb.gz
14	PDB:3jckG	0.468	0.596	2.885E-17	257	0.249	0.323	3jckG.pdb.gz	Atomic structure of the 26S proteasome lid reveals the mechanism of deubiquitinase inhibition.
15	PDB:5gjqV	0.460	0.591	9.227E-17	257	0.251	0.327	5gjqV.pdb.gz	An atomic structure of the human 26S proteasome.
16	PDB:6gvwB	0.362	0.451	1.684E-11	262	0.144	0.183	6gvwB.pdb.gz	Structural Basis of BRCC36 Function in DNA Repair and Immune Regulation.
17	PDB:5l4kU	0.434	0.491	1.055E-10	292	0.150	0.171	5l4kU.pdb.gz
18	PDB:6fvtU	0.409	0.445	2.069E-10	304	0.162	0.178	6fvtU.pdb.gz	Expanded Coverage of the 26S Proteasome Conformational Landscape Reveals Mechanisms of Peptidase Gating.
19	PDB:6ybd8	0.471	0.492	3.175E-10	317	0.162	0.170	6ybd8.pdb.gz
20	PDB:6zonF	0.432	0.528	7.949E-10	269	0.147	0.182	6zonF.pdb.gz	Structural basis for translational shutdown and immune evasion by the Nsp1 protein of SARS-CoV-2.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A024R7W9	0.0	701	334	1.000	1.000	A0A024R7W9_HUMAN COP9 constitutive photomorphogenic homolog subunit 5 (Arabidopsis), isoform CRA_a OS=Homo sapiens OX=9606 GN=COPS5 PE=2 SV=1
2	A7TX80	0.0	698	334	0.997	0.997	A7TX80_PIG COP9 constitutive photomorphogenic-like subunit 5 OS=Sus scrofa OX=9823 GN=COPS5 PE=2 SV=1
3	O35864	0.0	699	334	0.994	0.994	CSN5_MOUSE COP9 signalosome complex subunit 5 OS=Mus musculus OX=10090 GN=Cops5 PE=1 SV=3
4	Q6PC30	0.0	650	334	0.955	0.955	CSN5_DANRE COP9 signalosome complex subunit 5 OS=Danio rerio OX=7955 GN=cops5 PE=2 SV=1
5	Q92905	0.0	701	334	1.000	1.000	CSN5_HUMAN COP9 signalosome complex subunit 5 OS=Homo sapiens OX=9606 GN=COPS5 PE=1 SV=4
6	Q9XZ58	0.0	532	327	0.734	0.749	CSN5_DROME COP9 signalosome complex subunit 5 OS=Drosophila melanogaster OX=7227 GN=CSN5 PE=1 SV=1
7	Q54PF3	3.90e-170	478	332	0.662	0.666	CSN5_DICDI COP9 signalosome complex subunit 5 OS=Dictyostelium discoideum OX=44689 GN=csn5 PE=1 SV=1
8	Q8H936	5.29e-166	468	360	0.683	0.633	CSN5_ORYSJ COP9 signalosome complex subunit 5 OS=Oryza sativa subsp. japonica OX=39947 GN=CSN5 PE=1 SV=1
9	Q9FVU9	2.51e-160	454	358	0.683	0.637	CSN5B_ARATH COP9 signalosome complex subunit 5b OS=Arabidopsis thaliana OX=3702 GN=CSN5B PE=1 SV=1
10	Q8LAZ7	4.18e-160	453	357	0.668	0.625	CSN5A_ARATH COP9 signalosome complex subunit 5a OS=Arabidopsis thaliana OX=3702 GN=CSN5A PE=1 SV=2
11	P91001	7.86e-137	394	368	0.557	0.505	CSN5_CAEEL COP9 signalosome complex subunit 5 OS=Caenorhabditis elegans OX=6239 GN=csn-5 PE=1 SV=1
12	Q5BBF1	6.05e-125	363	335	0.536	0.534	CSN5_EMENI COP9 signalosome complex subunit 5 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=rri1 PE=1 SV=2
13	O94454	1.16e-81	251	299	0.380	0.425	CSN5_SCHPO COP9 signalosome complex subunit 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=csn5 PE=1 SV=1
14	Q12468	5.35e-45	161	440	0.249	0.189	CSN5_YEAST COP9 signalosome complex subunit 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RRI1 PE=1 SV=2
15	Q86IJ1	1.08e-42	151	306	0.269	0.294	PSDE_DICDI 26S proteasome non-ATPase regulatory subunit 14 OS=Dictyostelium discoideum OX=44689 GN=psmD14 PE=3 SV=1
16	Q9V3H2	1.67e-39	143	308	0.263	0.286	PSDE_DROME 26S proteasome non-ATPase regulatory subunit 14 OS=Drosophila melanogaster OX=7227 GN=Rpn11 PE=1 SV=1
17	Q9LT08	3.65e-39	142	308	0.290	0.315	PSDE_ARATH 26S proteasome non-ATPase regulatory subunit 14 homolog OS=Arabidopsis thaliana OX=3702 GN=RPN11 PE=1 SV=1
18	O00487	7.10e-39	141	310	0.240	0.258	PSDE_HUMAN 26S proteasome non-ATPase regulatory subunit 14 OS=Homo sapiens OX=9606 GN=PSMD14 PE=1 SV=1
19	O35593	7.10e-39	141	310	0.240	0.258	PSDE_MOUSE 26S proteasome non-ATPase regulatory subunit 14 OS=Mus musculus OX=10090 GN=Psmd14 PE=1 SV=2
20	Q17QP9	7.10e-39	141	310	0.240	0.258	Q17QP9_BOVIN Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 14 OS=Bos taurus OX=9913 GN=PSMD14 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF18323 CSN5_C	1.5e-20	85.3	Cop9 signalosome subunit 5 C-terminal domain
2	PF01398 JAB	1.4e-30	117.1	JAB1/Mov34/MPN/PAD-1 ubiquitin protease
3	PF14464 Prok-JAB	1.7	19.9	Prokaryotic homologs of the JAB domain
4	PF03665 UPF0172	67	14.9	Uncharacterised protein family (UPF0172)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9646.ENSAMEP00000013219

Rank	PPI partner	STRING score	Description
1	9646.ENSAMEP00000005317	0.998	COP9 signalosome subunit 4
2	9646.ENSAMEP00000001571	0.996	COP9 signalosome subunit 2
3	9646.ENSAMEP00000002398	0.996	COP9 signalosome subunit 3
4	9646.ENSAMEP00000011808	0.996	COP9 signalosome subunit 6
5	9646.ENSAMEP00000012730	0.994	COP9 signalosome subunit 8
6	9646.ENSAMEP00000018315	0.994	G protein pathway suppressor 1
7	9646.ENSAMEP00000017137	0.992	Neural precursor cell expressed, developmentally down-regulated 8
8	9646.ENSAMEP00000014865	0.990	COP9 signalosome subunit 7A
9	9646.ENSAMEP00000014685	0.987	Ring-box 1, E3 ubiquitin protein ligase
10	9646.ENSAMEP00000008308	0.975	Cullin 2
11	9646.ENSAMEP00000003070	0.971	Cullin 1
12	9646.ENSAMEP00000011315	0.971	Cyclin-dependent kinase inhibitor 1B (p27, Kip1)
13	9646.ENSAMEP00000017186	0.968	COP9 signalosome subunit 7B
14	9646.ENSAMEP00000017485	0.968	Damage-specific DNA binding protein 1, 127kDa
15	9646.ENSAMEP00000017825	0.967	Cellular tumor antigen p53
16	9646.ENSAMEP00000000245	0.953	Cullin 4B
17	9646.ENSAMEP00000012279	0.941	Cullin 3
18	9646.ENSAMEP00000000287	0.935	Jun proto-oncogene, AP-1 transcription factor subunit
19	9646.ENSAMEP00000003333	0.926	Hypoxia inducible factor 1, alpha subunit (basic helix-loop-helix transcription factor)
20	9646.ENSAMEP00000013535	0.926	Transcription elongation factor B (SIII), polypeptide 1 (15kDa, elongin C)

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0008233	0.994	peptidase activity
GO:0019783	0.911	ubiquitin-like protein peptidase activity
GO:0008237	0.829	metallopeptidase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.995	regulation of biological process
GO:0050794	0.989	regulation of cellular process
GO:0019222	0.972	regulation of metabolic process
GO:0080090	0.964	regulation of primary metabolic process
GO:0060255	0.964	regulation of macromolecule metabolic process
GO:0051171	0.963	regulation of nitrogen compound metabolic process
GO:0009987	0.921	cellular process
GO:0048518	0.919	positive regulation of biological process
GO:0065009	0.908	regulation of molecular function
GO:0071704	0.888	organic substance metabolic process
GO:0044238	0.879	primary metabolic process
GO:0048522	0.876	positive regulation of cellular process
GO:0006807	0.863	nitrogen compound metabolic process
GO:0043170	0.847	macromolecule metabolic process
GO:0010604	0.844	positive regulation of macromolecule metabolic process
GO:0051173	0.833	positive regulation of nitrogen compound metabolic process
GO:0019538	0.776	protein metabolic process
GO:0051247	0.748	positive regulation of protein metabolic process
GO:0010941	0.745	regulation of cell death
GO:0050790	0.683	regulation of catalytic activity
GO:0031323	0.674	regulation of cellular metabolic process
GO:0045862	0.651	positive regulation of proteolysis
GO:0052548	0.619	regulation of endopeptidase activity
GO:0051345	0.610	positive regulation of hydrolase activity
GO:0010950	0.596	positive regulation of endopeptidase activity
GO:2000116	0.572	regulation of cysteine-type endopeptidase activity
GO:0044237	0.569	cellular metabolic process
GO:0006919	0.563	activation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0009889	0.494	regulation of biosynthetic process
GO:0070647	0.484	protein modification by small protein conjugation or removal
GO:0010942	0.462	positive regulation of cell death
GO:0010468	0.461	regulation of gene expression
GO:0010556	0.456	regulation of macromolecule biosynthetic process
GO:0044260	0.433	cellular macromolecule metabolic process
GO:0071840	0.421	cellular component organization or biogenesis
GO:0031326	0.418	regulation of cellular biosynthetic process
GO:0042981	0.382	regulation of apoptotic process
GO:0032502	0.370	developmental process
GO:0006508	0.369	proteolysis
GO:0032501	0.358	multicellular organismal process
GO:0019219	0.324	regulation of nucleobase-containing compound metabolic process
GO:0050896	0.319	response to stimulus
GO:0048519	0.317	negative regulation of biological process
GO:0051726	0.317	regulation of cell cycle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.998	cytoplasm
GO:0005654	0.995	nucleoplasm
GO:0032991	0.986	protein-containing complex
GO:0005739	0.582	mitochondrion
GO:0008180	0.509	COP9 signalosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.-.-	0.994	Acting on peptide bonds (peptidases).

[back to server]