StarFunc result for job id Q92908

User Input

>input (595 residues)
MALTDGGWCLPKRFGAAGADASDSRAFPAREPSTPPSPISSSSSSCSRGGERGPGGASNC
GTPQLDTEAAAGPPARSLLLSSYASHPFGAPHGPSAPGVAGPGGNLSSWEDLLLFTDLDQ
AATASKLLWSSRGAKLSPFAPEQPEEMYQTLAALSSQGPAAYDGAPGGFVHSAAAAAAAA
AAASSPVYVPTTRVGSMLPGLPYHLQGSGSGPANHAGGAGAHPGWPQASADSPPYGSGGG
AAGGGAAGPGGAGSAAAHVSARFPYSPSPPMANGAAREPGGYAAAGSGGAGGVSGGGSSL
AAMGGREPQYSSLSAARPLNGTYHHHHHHHHHHPSPYSPYVGAPLTPAWPAGPFETPVLH
SLQSRAGAPLPVPRGPSADLLEDLSESRECVNCGSIQTPLWRRDGTGHYLCNACGLYSKM
NGLSRPLIKPQKRVPSSRRLGLSCANCHTTTTTLWRRNAEGEPVCNACGLYMKLHGVPRP
LAMKKEGIQTRKRKPKNINKSKTCSGNSNNSIPMTPTSTSSNSDDCSKNTSPTTQPTASG
AGAPVMTGAGESTNPENSELKYSGQDGLYIGVSLASPAEVTSSVRPDSWCALALA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q92908	0.999	0.999	2.026E-90	595	1.000	1.000	Q92908.pdb.gz	GATA6_HUMAN Transcription factor GATA-6 OS=Homo sapiens OX=9606 GN=GATA6 PE=1 SV=2
2	AFDB:O94720	0.135	0.142	1.395E-18	557	0.205	0.219	O94720.pdb.gz	FIL1_SCHPO Transcription factor fil1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=fil1 PE=2 SV=1
3	AFDB:Q4WCP6	0.107	0.077	5.984E-10	881	0.193	0.131	Q4WCP6.pdb.gz	Q4WCP6_ASPFU GATA transcriptional activator AreA OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=AFUA_6G01970 PE=4 SV=1
4	AFDB:Q10280	0.100	0.070	1.190E-9	855	0.198	0.138	Q10280.pdb.gz	GAF1_SCHPO Transcription factor gaf1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gaf1 PE=1 SV=2
5	AFDB:Q6FWW9	0.095	0.069	8.516E-4	823	0.180	0.130	Q6FWW9.pdb.gz	Q6FWW9_CANGA Candida glabrata strain CBS138 chromosome C complete sequence OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=GLN3 PE=4 SV=1
6	AFDB:Q8CGW4	0.078	0.066	1.201E-3	782	0.210	0.160	Q8CGW4.pdb.gz	SOX30_MOUSE Transcription factor SOX-30 OS=Mus musculus OX=10090 GN=Sox30 PE=1 SV=1
7	AFDB:R9PY21	0.076	0.067	3.742E-2	720	0.193	0.160	R9PY21.pdb.gz	R9PY21_DROME Sp1, isoform E OS=Drosophila melanogaster OX=7227 GN=Sp1 PE=4 SV=1
8	PDB:5dkaA	0.059	0.300	4.145E-2	96	0.040	0.250	5dkaA.pdb.gz	A C2HC zinc finger is essential for the RING-E2 interaction of the ubiquitin ligase RNF125.
9	AFDB:Q8NFU7	0.058	0.021	6.487E-2	2136	0.188	0.052	Q8NFU7.pdb.gz	TET1_HUMAN Methylcytosine dioxygenase TET1 OS=Homo sapiens OX=9606 GN=TET1 PE=1 SV=2
10	AFDB:Q5BIH1	0.076	0.059	7.974E-2	803	0.166	0.123	Q5BIH1.pdb.gz	Q5BIH1_DROME RE58581p OS=Drosophila melanogaster OX=7227 GN=klu PE=2 SV=1
11	AFDB:M9NE38	0.047	0.021	8.541E-2	1912	0.171	0.053	M9NE38.pdb.gz	JV_DROME Protein javelin OS=Drosophila melanogaster OX=7227 GN=jv PE=4 SV=1
12	PDB:1imlA	0.058	0.328	6.954E-1	76	0.024	0.184	1imlA.pdb.gz	Structure of the cysteine-rich intestinal protein, CRIP.
13	PDB:2pv0B	0.050	0.078	1.051	347	0.034	0.058	2pv0B.pdb.gz	DNMT3L connects unmethylated lysine 4 of histone H3 to de novo methylation of DNA.
14	PDB:1b8tA	0.064	0.162	1.291	192	0.040	0.125	1b8tA.pdb.gz	Solution structure of the chicken cysteine-rich protein, CRP1, a double-LIM protein implicated in muscle differentiation.
15	PDB:7pzye	0.057	0.496	1.383	55	0.017	0.182	7pzye.pdb.gz	E-site drug specificity of the human pathogen Candida albicans ribosome.
16	PDB:3n71A	0.054	0.067	1.700	468	0.015	0.019	3n71A.pdb.gz	Crystal Structure of Cardiac-specific Histone Methyltransferase SmyD1 Reveals Unusual Active Site Architecture.
17	PDB:4wa6D	0.062	0.085	1.822	415	0.015	0.022	4wa6D.pdb.gz	Structure of yeast SAGA DUBm with Sgf73 N59D mutant at 2.36 angstroms resolution
18	PDB:7p5zG	0.040	0.077	2.398	213	0.018	0.052	7p5zG.pdb.gz	Structural mechanism for the selective phosphorylation of DNA-loaded MCM double hexamers by the Dbf4-dependent kinase.
19	PDB:1q3bA	0.039	0.072	2.752	259	0.015	0.035	1q3bA.pdb.gz	Structure of the uncomplexed DNA repair enzyme endonuclease VIII indicates significant interdomain flexibility.
20	PDB:6e1qA	0.037	0.038	2.752	569	0.020	0.021	6e1qA.pdb.gz	Modification of auxinic phenoxyalkanoic acid herbicides by the acyl acid amido synthetase GH3.15 from Arabidopsis.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P46153	0.0	861	587	0.892	0.905	GATA6_RAT Transcription factor GATA-6 OS=Rattus norvegicus OX=10116 GN=Gata6 PE=1 SV=2
2	Q61169	0.0	865	589	0.881	0.890	GATA6_MOUSE Transcription factor GATA-6 OS=Mus musculus OX=10090 GN=Gata6 PE=1 SV=3
3	Q92908	0.0	1179	595	1.000	1.000	GATA6_HUMAN Transcription factor GATA-6 OS=Homo sapiens OX=9606 GN=GATA6 PE=1 SV=2
4	P70005	3.45e-142	419	391	0.444	0.675	GAT6B_XENLA GATA-binding factor 6-B OS=Xenopus laevis OX=8355 GN=gata6-b PE=2 SV=1
5	Q6NW63	4.20e-135	405	501	0.424	0.503	Q6NW63_DANRE GATA-binding protein 6 OS=Danio rerio OX=7955 GN=GATA-5 PE=2 SV=2
6	Q91677	1.17e-110	338	392	0.326	0.495	GATA4_XENLA Transcription factor GATA-4 OS=Xenopus laevis OX=8355 GN=gata4 PE=2 SV=1
7	P43695	6.10e-105	323	390	0.346	0.528	GAT5A_XENLA GATA-binding factor 5-A OS=Xenopus laevis OX=8355 GN=gata5-a PE=2 SV=1
8	P97489	9.57e-99	308	404	0.346	0.510	GATA5_MOUSE Transcription factor GATA-5 OS=Mus musculus OX=10090 GN=Gata5 PE=1 SV=2
9	P43691	2.28e-95	298	380	0.328	0.513	GATA4_CHICK Transcription factor GATA-4 (Fragment) OS=Gallus gallus OX=9031 GN=GATA4 PE=2 SV=1
10	Q9W6U0	7.47e-93	292	383	0.334	0.520	Q9W6U0_DANRE GATA-binding protein 5 OS=Danio rerio OX=7955 GN=cb634 PE=2 SV=2
11	Q09JY7	6.09e-89	281	352	0.287	0.486	Q09JY7_DANRE GATA4 OS=Danio rerio OX=7955 GN=gata PE=2 SV=1
12	P43692	4.33e-88	280	391	0.346	0.527	GATA5_CHICK Transcription factor GATA-5 OS=Gallus gallus OX=9031 GN=GATA5 PE=1 SV=1
13	F1NZV5	3.09e-86	275	391	0.346	0.527	F1NZV5_CHICK GATA binding protein 5 OS=Gallus gallus OX=9031 GN=GATA5 PE=4 SV=3
14	Q8MIM5	3.11e-85	274	442	0.250	0.337	Q8MIM5_PIG Transcription factor GATA-4 OS=Sus scrofa OX=9823 PE=2 SV=1
15	P43694	4.33e-85	274	442	0.250	0.337	GATA4_HUMAN Transcription factor GATA-4 OS=Homo sapiens OX=9606 GN=GATA4 PE=1 SV=2
16	Q08369	3.31e-84	271	441	0.247	0.333	GATA4_MOUSE Transcription factor GATA-4 OS=Mus musculus OX=10090 GN=Gata4 PE=1 SV=4
17	P46152	7.13e-84	271	440	0.247	0.334	GATA4_RAT Transcription factor GATA-4 OS=Rattus norvegicus OX=10116 GN=Gata4 PE=1 SV=1
18	A0A087WZ09	1.29e-83	270	441	0.250	0.338	A0A087WZ09_HUMAN Transcription factor GATA-4 OS=Homo sapiens OX=9606 GN=GATA4 PE=1 SV=1
19	I3LUZ9	3.06e-83	269	443	0.249	0.334	I3LUZ9_PIG GATA binding protein 4 OS=Sus scrofa OX=9823 GN=GATA4 PE=4 SV=2
20	Q9BWX5	1.91e-77	253	397	0.326	0.489	GATA5_HUMAN Transcription factor GATA-5 OS=Homo sapiens OX=9606 GN=GATA5 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF19133 DUF5816	8e+02	11.7	Family of unknown function (DUF5816)
2	PF18912 DZR_2	3.8e+02	12.4	Double zinc ribbon domain
3	PF00320 GATA	1.5e-26	103.0	GATA zinc finger
4	PF05349 GATA-N	1.2e-55	200.0	GATA-type transcription activator, N-terminal
5	PF08271 TF_Zn_Ribbon	0.003	28.3	TFIIB zinc-binding
6	PF09723 Zn-ribbon_8	3.8e+02	12.6	Zinc ribbon domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000269216

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000357348	0.954	Hairy/enhancer-of-split related with YRPW motif protein 2
2	9606.ENSP00000338272	0.940	Hairy/enhancer-of-split related with YRPW motif protein 1
3	9606.ENSP00000397082	0.924	Pulmonary surfactant-associated protein A1
4	9606.ENSP00000361400	0.922	Pulmonary surfactant-associated protein A2
5	9606.ENSP00000157600	0.905	LIM and cysteine-rich domains protein 1
6	9606.ENSP00000428331	0.900	Surfactant-associated protein 3
7	9606.ENSP00000384179	0.879	Zinc finger protein ZFPM2
8	9606.ENSP00000327758	0.873	Homeobox protein Nkx-2.5
9	9606.ENSP00000297316	0.872	Transcription factor SOX-17
10	9606.ENSP00000373783	0.857	Lysyl oxidase homolog 2
11	9606.ENSP00000400341	0.832	Hepatocyte nuclear factor 3-beta
12	9606.ENSP00000370408	0.818	Homeobox protein CDX-2
13	9606.ENSP00000384434	0.818	GATA-type zinc finger protein 1
14	9606.ENSP00000326630	0.804	Zinc finger protein ZFPM1
15	9606.ENSP00000229307	0.801	Homeobox protein NANOG
16	9606.ENSP00000257566	0.797	T-box transcription factor TBX3
17	9606.ENSP00000309913	0.786	T-box transcription factor TBX5
18	9606.ENSP00000301921	0.777	Transcription factor SOX-7
19	9606.ENSP00000451145	0.777	Uncharacterized protein
20	9606.ENSP00000312987	0.772	Hepatocyte nuclear factor 4-alpha

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0000981	1.000	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0061629	1.000	RNA polymerase II-specific DNA-binding transcription factor binding
GO:0000987	0.999	cis-regulatory region sequence-specific DNA binding
GO:0001221	0.998	transcription coregulator binding
GO:0001223	0.972	transcription coactivator binding
GO:0019899	0.933	enzyme binding
GO:0019900	0.911	kinase binding
GO:0019901	0.904	protein kinase binding
GO:0000977	0.738	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0051525	0.557	NFAT protein binding
GO:0000978	0.537	RNA polymerase II cis-regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0048522	0.996	positive regulation of cellular process
GO:0010604	0.995	positive regulation of macromolecule metabolic process
GO:0006355	0.995	regulation of DNA-templated transcription
GO:0010557	0.994	positive regulation of macromolecule biosynthetic process
GO:0051254	0.994	positive regulation of RNA metabolic process
GO:0009987	0.982	cellular process
GO:0032501	0.981	multicellular organismal process
GO:0048856	0.978	anatomical structure development
GO:0045893	0.964	positive regulation of DNA-templated transcription
GO:0048513	0.961	animal organ development
GO:0007275	0.950	multicellular organism development
GO:0050896	0.942	response to stimulus
GO:0045944	0.940	positive regulation of transcription by RNA polymerase II
GO:0048731	0.922	system development
GO:0009653	0.914	anatomical structure morphogenesis
GO:0030154	0.906	cell differentiation
GO:0048519	0.851	negative regulation of biological process
GO:0009888	0.821	tissue development
GO:0048523	0.779	negative regulation of cellular process
GO:0072359	0.754	circulatory system development
GO:0042221	0.727	response to chemical
GO:0010605	0.674	negative regulation of macromolecule metabolic process
GO:0051716	0.670	cellular response to stimulus
GO:0051239	0.656	regulation of multicellular organismal process
GO:0031324	0.637	negative regulation of cellular metabolic process
GO:0048583	0.635	regulation of response to stimulus
GO:0051172	0.624	negative regulation of nitrogen compound metabolic process
GO:0010646	0.608	regulation of cell communication
GO:0023051	0.582	regulation of signaling
GO:0010558	0.526	negative regulation of macromolecule biosynthetic process
GO:0031327	0.525	negative regulation of cellular biosynthetic process
GO:0045892	0.519	negative regulation of DNA-templated transcription
GO:0042127	0.488	regulation of cell population proliferation
GO:0050793	0.479	regulation of developmental process
GO:0009887	0.474	animal organ morphogenesis
GO:0000122	0.427	negative regulation of transcription by RNA polymerase II
GO:0010033	0.387	response to organic substance
GO:0007507	0.336	heart development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	0.999	nucleus
GO:0070013	0.943	intracellular organelle lumen
GO:0031981	0.886	nuclear lumen
GO:0005654	0.884	nucleoplasm
GO:0016020	0.557	membrane
GO:0005737	0.557	cytoplasm
GO:0012505	0.457	endomembrane system
GO:0032991	0.370	protein-containing complex
GO:0031965	0.325	nuclear membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]