StarFunc result for job id Q92913

User Input

>input (245 residues)
MAAAIASSLIRQKRQAREREKSNACKCVSSPSKGKTSCDKNKLNVFSRVKLFGSKKRRRR
RPEPQLKGIVTKLYSRQGYHLQLQADGTIDGTKDEDSTYTLFNLIPVGLRVVAIQGVQTK
LYLAMNSEGYLYTSELFTPECKFKESVFENYYVTYSSMIYRQQQSGRGWYLGLNKEGEIM
KGNHVKKNKPAAHFLPKPLKVAMYKEPSLHDLTEFSRSGSGTPTKSRSVSGVLNGGKSMS
HNEST

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A6P7H6	0.776	0.776	6.545E-41	245	0.931	0.931	A6P7H6.pdb.gz	FGF13_XENLA Fibroblast growth factor 13 OS=Xenopus laevis OX=8355 GN=fgf13 PE=2 SV=1
2	AFDB:P70379	0.739	0.734	7.641E-33	247	0.678	0.672	P70379.pdb.gz	FGF14_MOUSE Fibroblast growth factor 14 OS=Mus musculus OX=10090 GN=Fgf14 PE=2 SV=1
3	AFDB:P61150	0.705	0.711	5.635E-32	243	0.678	0.683	P61150.pdb.gz	FGF12_RAT Fibroblast growth factor 12 OS=Rattus norvegicus OX=10116 GN=Fgf12 PE=1 SV=1
4	AFDB:Q92914	0.629	0.682	6.329E-26	225	0.514	0.560	Q92914.pdb.gz	FGF11_HUMAN Fibroblast growth factor 11 OS=Homo sapiens OX=9606 GN=FGF11 PE=1 SV=1
5	PDB:4jq0A	0.567	0.980	1.172E-20	141	0.441	0.766	4jq0A.pdb.gz	Structural analyses of Ca(2+)/CaM interaction with NaV channel C-termini reveal mechanisms of calcium-dependent regulation.
6	AFDB:P21781	0.533	0.669	1.822E-15	194	0.208	0.263	P21781.pdb.gz	FGF7_HUMAN Fibroblast growth factor 7 OS=Homo sapiens OX=9606 GN=FGF7 PE=1 SV=1
7	AFDB:Q9EST9	0.526	0.606	2.659E-15	212	0.237	0.274	Q9EST9.pdb.gz	FGF20_RAT Fibroblast growth factor 20 OS=Rattus norvegicus OX=10116 GN=Fgf20 PE=2 SV=1
8	AFDB:Q38PL0	0.515	0.604	4.324E-15	208	0.253	0.298	Q38PL0.pdb.gz	Q38PL0_DANRE Fibroblast growth factor OS=Danio rerio OX=7955 GN=dob PE=2 SV=1
9	AFDB:O43320	0.518	0.611	5.084E-15	207	0.229	0.271	O43320.pdb.gz	FGF16_HUMAN Fibroblast growth factor 16 OS=Homo sapiens OX=9606 GN=FGF16 PE=1 SV=1
10	AFDB:P31371	0.525	0.617	5.978E-15	208	0.241	0.284	P31371.pdb.gz	FGF9_HUMAN Fibroblast growth factor 9 OS=Homo sapiens OX=9606 GN=FGF9 PE=1 SV=3
11	AFDB:O42407	0.527	0.608	6.660E-15	212	0.208	0.241	O42407.pdb.gz	O42407_CHICK Fibroblast growth factor OS=Gallus gallus OX=9031 PE=2 SV=2
12	PDB:3f1rA	0.525	0.812	8.543E-15	157	0.224	0.350	3f1rA.pdb.gz	Homodimerization controls the fibroblast growth factor 9 subfamily's receptor binding and heparan sulfate-dependent diffusion in the extracellular matrix
13	PDB:1ry7A	0.475	0.757	1.966E-10	151	0.196	0.318	1ry7A.pdb.gz
14	PDB:6b0tA	0.443	0.231	4.286E-6	487	0.094	0.047	6b0tA.pdb.gz	Structural Insights into the Induced-fit Inhibition of Fascin by a Small-Molecule Inhibitor.
15	PDB:4qd2B	0.439	0.709	4.370E-5	143	0.053	0.091	4qd2B.pdb.gz	Molecular basis for disruption of E-cadherin adhesion by botulinum neurotoxin A complex.
16	PDB:7t3qA	0.390	0.056	6.502E-4	2103	0.102	0.012	7t3qA.pdb.gz	Structural basis for activation and gating of IP 3 receptors.
17	PDB:7t3pA	0.400	0.057	8.070E-4	2066	0.102	0.012	7t3pA.pdb.gz	Structural basis for activation and gating of IP 3 receptors.
18	PDB:1t9fA	0.403	0.540	1.243E-3	178	0.082	0.112	1t9fA.pdb.gz
19	PDB:3malA	0.398	0.526	1.243E-3	181	0.098	0.133	3malA.pdb.gz
20	PDB:4izeA	0.399	0.609	1.719E-3	152	0.078	0.125	4izeA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A8K1P5	0.0	509	245	1.000	1.000	A8K1P5_HUMAN Fibroblast growth factor OS=Homo sapiens OX=9606 GN=FGF13 PE=2 SV=1
2	P70377	0.0	506	245	0.996	0.996	FGF13_MOUSE Fibroblast growth factor 13 OS=Mus musculus OX=10090 GN=Fgf13 PE=1 SV=2
3	Q92913	0.0	509	245	1.000	1.000	FGF13_HUMAN Fibroblast growth factor 13 OS=Homo sapiens OX=9606 GN=FGF13 PE=1 SV=1
4	Q9ERW3	0.0	506	245	0.996	0.996	FGF13_RAT Fibroblast growth factor 13 OS=Rattus norvegicus OX=10116 GN=Fgf13 PE=1 SV=2
5	A6P7H6	1.43e-165	459	245	0.931	0.931	FGF13_XENLA Fibroblast growth factor 13 OS=Xenopus laevis OX=8355 GN=fgf13 PE=2 SV=1
6	Q8R5L7	1.60e-118	340	247	0.682	0.676	FGF14_RAT Fibroblast growth factor 14 OS=Rattus norvegicus OX=10116 GN=Fgf14 PE=2 SV=1
7	Q92915	4.53e-118	338	247	0.682	0.676	FGF14_HUMAN Fibroblast growth factor 14 OS=Homo sapiens OX=9606 GN=FGF14 PE=1 SV=1
8	P70379	6.54e-117	336	247	0.678	0.672	FGF14_MOUSE Fibroblast growth factor 14 OS=Mus musculus OX=10090 GN=Fgf14 PE=2 SV=1
9	P61150	2.74e-115	332	243	0.673	0.679	FGF12_RAT Fibroblast growth factor 12 OS=Rattus norvegicus OX=10116 GN=Fgf12 PE=1 SV=1
10	P61328	2.74e-115	332	243	0.673	0.679	FGF12_HUMAN Fibroblast growth factor 12 OS=Homo sapiens OX=9606 GN=FGF12 PE=1 SV=1
11	P61329	2.74e-115	332	243	0.673	0.679	FGF12_MOUSE Fibroblast growth factor 12 OS=Mus musculus OX=10090 GN=Fgf12 PE=1 SV=1
12	Q92914	2.78e-86	257	225	0.531	0.578	FGF11_HUMAN Fibroblast growth factor 11 OS=Homo sapiens OX=9606 GN=FGF11 PE=1 SV=1
13	Q9ESL9	1.22e-33	122	211	0.241	0.280	FGF20_MOUSE Fibroblast growth factor 20 OS=Mus musculus OX=10090 GN=Fgf20 PE=2 SV=2
14	Q9NP95	2.02e-33	122	211	0.237	0.275	FGF20_HUMAN Fibroblast growth factor 20 OS=Homo sapiens OX=9606 GN=FGF20 PE=1 SV=1
15	Q38PL0	2.52e-33	121	208	0.249	0.293	Q38PL0_DANRE Fibroblast growth factor OS=Danio rerio OX=7955 GN=dob PE=2 SV=1
16	P36364	3.18e-33	121	208	0.237	0.279	FGF9_RAT Fibroblast growth factor 9 OS=Rattus norvegicus OX=10116 GN=Fgf9 PE=2 SV=2
17	P54130	3.18e-33	121	208	0.237	0.279	FGF9_MOUSE Fibroblast growth factor 9 OS=Mus musculus OX=10090 GN=Fgf9 PE=2 SV=2
18	P31371	3.54e-33	121	208	0.237	0.279	FGF9_HUMAN Fibroblast growth factor 9 OS=Homo sapiens OX=9606 GN=FGF9 PE=1 SV=3
19	Q9EST9	4.06e-33	121	212	0.237	0.274	FGF20_RAT Fibroblast growth factor 20 OS=Rattus norvegicus OX=10116 GN=Fgf20 PE=2 SV=1
20	Q2HXK8	8.53e-32	117	203	0.220	0.266	FGF16_DANRE Fibroblast growth factor 16 OS=Danio rerio OX=7955 GN=fgf16 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03498 CDtoxinA	1.3e+02	13.6	Cytolethal distending toxin A/C domain
2	PF16067 DUF4809	5.6e+02	11.9	Domain of unknown function (DUF4809)
3	PF06268 Fascin	3.8	19.2	Fascin domain
4	PF00167 FGF	1.2e-39	146.6	Fibroblast growth factor
5	PF08515 TGF_beta_GS	1.7e+02	13.2	Transforming growth factor beta type I GS-motif

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61622.XP_010354533.1

Rank	PPI partner	STRING score	Description
1	61622.XP_010369798.1	0.909	Mediates the voltage-dependent sodium ion permeability of excitable membranes. Assuming opened or closed conformations in response to the voltage difference across the membrane, the protein forms a sodium-selective channel through which Na(+) ions may pass in accordance with their electrochemical gradient.
2	61622.XP_010383576.1	0.907	Fibroblast growth factor receptor 1
3	61622.XP_010378799.1	0.827	Fibroblast growth factor receptor 2 isoform X1
4	61622.XP_010363600.1	0.808	Mediates the voltage-dependent sodium ion permeability of excitable membranes. Assuming opened or closed conformations in response to the voltage difference across the membrane, the protein forms a sodium-selective channel through which Na(+) ions may pass in accordance with their electrochemical gradient.
5	61622.XP_010372305.1	0.784	Sodium channel protein type 8 subunit alpha isoform X1
6	61622.XP_010382646.1	0.780	Fibroblast growth factor receptor 3 isoform X1
7	61622.XP_010373632.1	0.747	Fibroblast growth factor receptor-like 1
8	61622.XP_010387372.1	0.733	EGF stimulates the growth of various epidermal and epithelial tissues in vivo and in vitro and of some fibroblasts in cell culture. Magnesiotropic hormone that stimulates magnesium reabsorption in the renal distal convoluted tubule via engagement of EGFR and activation of the magnesium channel TRPM6
9	61622.XP_010355571.1	0.707	Insulin-like growth factor I isoform X1
10	61622.XP_010357745.1	0.700	Basement membrane-specific heparan sulfate proteoglycan core protein-like
11	61622.XP_010362674.1	0.700	Basement membrane-specific heparan sulfate proteoglycan core protein
12	61622.XP_010384710.1	0.691	Fibroblast growth factor receptor 4
13	61622.XP_010368048.1	0.684	Belongs to the PDGF/VEGF growth factor family.
14	61622.XP_010386218.1	0.682	Potent mitogen for mature parenchymal hepatocyte cells, seems to be a hepatotrophic factor, and acts as a growth factor for a broad spectrum of tissues and cell types. Activating ligand for the receptor tyrosine kinase MET by binding to it and promoting its dimerization.
15	61622.XP_010386077.1	0.678	Bone morphogenetic protein 2
16	61622.XP_010361178.1	0.676	Kinase insert domain receptor
17	61622.XP_010370358.1	0.660	Bone morphogenetic protein 4
18	61622.XP_010380355.1	0.646	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
19	61622.XP_010370484.1	0.638	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 8 mRNAs, 6100 ESTs, 18 Proteins, and 96% coverage of the annotated genomic feature by RNAseq alignments
20	61622.XP_010360648.1	0.636	Fms related tyrosine kinase 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008083	0.998	growth factor activity
GO:0016247	0.988	channel regulator activity
GO:0017080	0.983	sodium channel regulator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032501	0.997	multicellular organismal process
GO:0048856	0.996	anatomical structure development
GO:0009987	0.995	cellular process
GO:0050896	0.994	response to stimulus
GO:0050794	0.992	regulation of cellular process
GO:0007275	0.977	multicellular organism development
GO:0048731	0.918	system development
GO:0007154	0.860	cell communication
GO:0048518	0.859	positive regulation of biological process
GO:0023052	0.857	signaling
GO:0051716	0.828	cellular response to stimulus
GO:0007399	0.815	nervous system development
GO:0007165	0.813	signal transduction
GO:0048522	0.792	positive regulation of cellular process
GO:0048583	0.707	regulation of response to stimulus
GO:0035556	0.697	intracellular signal transduction
GO:0048519	0.622	negative regulation of biological process
GO:0042221	0.565	response to chemical
GO:0023051	0.534	regulation of signaling
GO:0010646	0.528	regulation of cell communication
GO:0048523	0.506	negative regulation of cellular process
GO:0009966	0.494	regulation of signal transduction
GO:0030154	0.460	cell differentiation
GO:0048513	0.427	animal organ development
GO:0050793	0.420	regulation of developmental process
GO:0051239	0.410	regulation of multicellular organismal process
GO:1902531	0.394	regulation of intracellular signal transduction
GO:0009653	0.359	anatomical structure morphogenesis
GO:0060255	0.307	regulation of macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043231	0.998	intracellular membrane-bounded organelle
GO:0005829	0.991	cytosol
GO:0005634	0.985	nucleus
GO:0005576	0.836	extracellular region
GO:0071944	0.760	cell periphery
GO:0016020	0.669	membrane
GO:0070013	0.330	intracellular organelle lumen
GO:0005615	0.314	extracellular space

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]